Recombinant Uncharacterized protein YhiD (yhiD)

Shipped with Ice Packs
In Stock

Description

Key Optimization Challenges

  • Solubility: Requires membrane protein-specific lysis buffers (1% n-dodecyl β-D-maltoside recommended)

  • Yield: 0.5-1.2 mg/L culture in shake-flask conditions

  • Stability: Lyophilized form maintains activity for 6 months at -80°C when stored with 6% trehalose

Acid Resistance Mechanism

YhiD operates synergistically with acid response systems:

Mutant StrainViability at pH 2.1 (CFU/mL)Reference
Wild-type E. coli5.8×10⁸
ΔyhiD1.2×10⁷
ΔyhiD/ΔhdeD/ΔgadE<1.0×10⁶

The protein demonstrates pH-dependent conformational changes, with optimal stability between pH 5.0-7.0 . Structural modeling suggests a proton antiporter mechanism involving conserved aspartate residues (D45, D89, D172) .

Associated Proteins & Pathways

Functional network:

  • hdeA: Chaperone for acid-induced proteins (PDB 1YG9)

  • gadE: Central regulator of glutamate-dependent acid resistance

  • mgtC: Magnesium transporter with 32% sequence homology

Protein-protein interaction studies reveal YhiD forms transient complexes with HdeD during membrane stress response .

Industrial Biotechnology

  • pH-stable bioreactor cultures

  • Heavy metal biosensor development (Mg²⁺/Mn²⁺ transport capability)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format during order placement for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is assigned during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
yhiD; Z4920; ECs4388; Uncharacterized protein YhiD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
yhiD
Target Protein Sequence
MTAEFIIRLILAAIACGAIGMERQMRGKGAGLRTHVLIGMGSALFMIVSKYGFADVLSLD HVGLDPSRIAAQVVTGVGFIGAGNILVRNQNIVGLTTAADIWVTAAIGMVIGSGMYELGI YGSVMTLLVLEVFHQLTFRLMNKNYHLQLTLVNGNTVSMLDWFKQQKIKTDLVSLQENED HEVVAIDIQLHATTSIEDLLRLLKGMAGVKGVSIS
Uniprot No.

Target Background

Database Links

KEGG: ece:Z4920

STRING: 155864.Z4920

Protein Families
MgtC/SapB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal expression systems for recombinant YhiD protein production?

When expressing recombinant YhiD, several expression systems can be employed depending on your research objectives. E. coli-based systems often provide high yields for initial characterization studies, while eukaryotic systems may be preferred for studying post-translational modifications.

For optimal expression in bacterial systems, consider the following protocol framework:

For experimental design, implement controlled expression trials with varying induction parameters to determine optimal conditions for your specific construct. When facing unexpected expression patterns, evaluate codon usage and optimize accordingly .

What purification strategy yields the highest purity of recombinant YhiD protein?

A multi-step purification strategy typically yields the highest purity for recombinant YhiD. Begin with affinity chromatography using a compatible tag system, followed by intermediate purification steps and polishing techniques.

Recommended purification workflow:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA for His-tagged YhiD constructs

  • Intermediate purification: Ion exchange chromatography based on YhiD's theoretical pI

  • Polishing: Size exclusion chromatography for removing aggregates and obtaining homogeneous protein preparations

When evaluating purification efficacy, use SDS-PAGE and Western blotting to confirm identity and purity. For higher sensitivity, consider mass spectrometry analysis to detect trace contaminants .

If your data shows unexpected binding or elution patterns during purification, systematically adjust buffer conditions (pH, salt concentration, reducing agents) while maintaining protein stability .

How should experiments be designed to determine YhiD's structural characteristics?

Designing experiments to elucidate YhiD's structural features requires a multi-technique approach with proper controls and validation steps.

Implement the following experimental design strategy:

  • Primary structure analysis: Use mass spectrometry to confirm sequence and identify post-translational modifications

  • Secondary structure analysis: Employ circular dichroism (CD) spectroscopy under varying buffer conditions

  • Tertiary structure analysis: Utilize X-ray crystallography or nuclear magnetic resonance (NMR) spectroscopy

  • Quaternary structure analysis: Apply analytical ultracentrifugation or size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

When designing these experiments, include both positive controls (well-characterized proteins of similar size/type) and negative controls. Randomize sample order and perform technical replicates to minimize systematic errors .

If structural data contradicts computational predictions, consider alternative experimental conditions or complementary techniques before rejecting your hypothesis .

What experimental approaches are most effective for determining YhiD's function?

To systematically characterize YhiD's function, employ a multi-faceted experimental approach:

  • Bioinformatic analysis: Predict potential functions based on sequence homology, domain architecture, and evolutionary conservation

  • Protein-protein interaction studies: Use yeast two-hybrid screening, co-immunoprecipitation, or proximity labeling techniques

  • In vitro activity assays: Test predicted enzymatic functions with appropriate substrates

  • Gene knockout/knockdown studies: Evaluate phenotypic changes in appropriate model systems

  • Localization studies: Determine subcellular localization using fluorescent tagging or fractionation techniques

For robust experimental design, implement the following controls:

Control TypePurposeExamples
Positive ControlsValidate assay functionalityKnown interacting proteins for PPI assays
Negative ControlsIdentify false positivesEmpty vectors, unrelated proteins
Technical ControlsAssess method reproducibilityMultiple replicates, different conditions
Biological ControlsAccount for natural variationIndependent biological samples

When interpreting results, be particularly attentive to discrepancies between in silico predictions and experimental outcomes, as these may indicate novel functions .

How should contradictory data regarding YhiD characterization be addressed?

When encountering contradictory data in YhiD research, implement a systematic approach to resolve discrepancies:

  • Thoroughly examine the data: Review raw data, experimental conditions, and analysis methods to identify potential sources of variation

  • Evaluate initial assumptions: Reassess your hypothesis and experimental design to determine if they were appropriate

  • Consider alternative explanations: Develop new hypotheses that might account for unexpected results

  • Modify data collection methods: Refine experimental protocols to address potential methodological issues

  • Implement additional controls: Add controls specific to the contradiction observed

When data contradicts your hypothesis, maintain scientific integrity by documenting all findings transparently. Consider the following decision framework:

Data ScenarioRecommended ApproachReporting Strategy
Minor contradictionsAdditional replicates with modified conditionsReport variations with statistical analysis
Major contradictionsComplete redesign of experimental approachDocument both original hypothesis and new findings
Consistent contradictions across methodsConsider paradigm shift in understanding YhiDPublish findings as novel discovery

Remember that contradictory data often leads to important scientific breakthroughs and novel understanding of protein function .

What statistical approaches are appropriate for analyzing YhiD functional assay data?

Select statistical methods based on your experimental design and data characteristics:

  • For comparative studies (wild-type vs. mutant YhiD): Use t-tests for normally distributed data or non-parametric alternatives (Mann-Whitney U test) when normality cannot be assumed

  • For multi-condition experiments: Implement ANOVA with appropriate post-hoc tests (Tukey's, Bonferroni, etc.)

  • For dose-response relationships: Apply regression analysis or non-linear curve fitting

  • For time-course experiments: Consider repeated measures ANOVA or mixed-effects models

When designing experiments, perform power analysis to determine appropriate sample sizes. For YhiD functional assays, consider the following statistical framework:

Always report effect sizes alongside p-values to provide context for the biological significance of your findings .

How can systematic review methodologies be applied to consolidate existing knowledge about YhiD?

Apply rigorous systematic review approaches to synthesize available YhiD research:

  • Define clear review scope: Formulate specific research questions about YhiD function, structure, or expression patterns

  • Develop comprehensive search strategy: Search multiple electronic databases using controlled vocabulary and free-text terms related to YhiD

  • Implement thorough screening process: Use a two-reviewer approach for title/abstract screening and full-text review

  • Extract data systematically: Create standardized extraction forms to capture methodological details and findings

  • Assess study quality: Evaluate research quality using appropriate quality assessment tools based on study design

  • Synthesize findings: Use narrative synthesis or meta-analysis where appropriate

When conducting systematic reviews on understudied proteins like YhiD, consider these methodological recommendations:

Review ComponentBest PracticeLimitation to Consider
Literature SearchSearch multiple resources including databases, reference lists, and preprints Excluding non-English literature may introduce bias
ScreeningConsider text-mining approaches for initial screening Automated tools may miss relevant studies with non-standard terminology
Data ExtractionDual independent extractionResource-intensive for large reviews
Quality AssessmentUse domain-specific critical appraisal toolsTools may not capture all quality elements for protein research

A well-conducted systematic review can identify knowledge gaps and guide future YhiD research directions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.