Recombinant Uncharacterized protein yidX (yidX)

What is the full amino acid sequence of Recombinant Uncharacterized Protein YidX?

The complete amino acid sequence of YidX (UniProt accession number P0ADM7) is as follows:

MKLNFKGFFKAAGLLFPLALMSLSGCISYALVSHTAKGSSGKYQSQSDTITGLSQAKDSNGT
KGYVFVGESLDYLITDGADDIVKMLNDPALNRHNIQVADDARFVLNAGKKKFTGTISLYY
YWNNEEEKALATHYGFACGVQHCTRSLENLKGTIHEKNKNMDYSKVMAFYHPFKVRFYEY
YSPRGIPDGVSAALLPVTVTLDIITAPLQFLVVYAVNQ

The full-length protein consists of 218 amino acids and contains a signal peptide at its N-terminus (approximately residues 1-20) . This sequence information is essential for designing expression constructs, planning mutagenesis studies, and predicting potential functional domains.

Which expression systems are most suitable for producing Recombinant YidX protein?

Multiple expression systems can be used for YidX production, each with distinct advantages based on research requirements:

What is the optimal storage condition for purified Recombinant YidX?

To maintain the stability and activity of purified Recombinant YidX protein, implement the following storage protocol:

• Store stock solution at -20°C in a Tris-based buffer containing 50% glycerol

• For extended storage periods, maintain at -80°C to minimize protein degradation

• Avoid repeated freeze-thaw cycles as they can lead to protein denaturation and aggregation

• Working aliquots can be stored at 4°C for up to one week

• Consider adding appropriate protease inhibitors if degradation is observed

For optimization experiments, it is advisable to test stability under various buffer conditions (e.g., varying pH, salt concentration, and additives) to determine the specific conditions that maximize the shelf-life of YidX for your particular application.

How should experiments be designed to characterize the function of an uncharacterized protein like YidX?

Characterizing an uncharacterized protein like YidX requires a comprehensive approach:

• Bioinformatic analysis:

  • Sequence homology searches to identify potential related proteins

  • Secondary structure prediction to identify conserved domains

  • Analysis of genomic context to identify potential functional associations

• Expression and purification optimization:

  • Test multiple expression systems (start with E. coli for high yield)

  • Optimize expression conditions (temperature, induction time, media composition)

  • Design construct variants (full-length vs. truncated versions)

• Structural characterization:

  • Circular dichroism (CD) spectroscopy for secondary structure assessment

  • HDX-MS (hydrogen-deuterium exchange mass spectrometry) to identify stable domains and flexible regions

  • X-ray crystallography or cryo-EM for high-resolution structure determination

• Functional assays:

  • Protein-protein interaction studies (pull-down assays, co-immunoprecipitation)

  • Enzymatic activity screening using substrate panels

  • Knockout/knockdown studies to assess cellular phenotypes

• In vivo studies:

  • Localization studies using tagged constructs

  • Expression analysis under different growth conditions

  • Complementation studies in knockout strains

This systematic approach allows researchers to gradually build evidence for the protein's function while maintaining robust experimental controls at each stage.

How can truncation scanning be implemented to identify functional domains of YidX?

Truncation scanning is a valuable approach for identifying functional domains in uncharacterized proteins like YidX. Here's a methodology based on successful applications in similar proteins:

• Initial construct design based on HDX-MS data:

  • Perform HDX-MS analysis to identify regions with low deuteration rates (indicating well-structured domains)

  • Design initial constructs based on these protected regions and secondary structure predictions

• Systematic truncation strategy:

  • Create a series of N-terminal and C-terminal truncations (typically removing 10-20 amino acids at a time)

  • For fine-tuning, design smaller truncations (1-2 amino acids) around potential domain boundaries

• Expression screening:

  • Express all constructs in E. coli for rapid screening

  • Evaluate expression levels, solubility, and stability of each construct

  • Select constructs with highest soluble expression for further characterization

• Data organization and analysis:

• Function and activity testing:

  • Test selected constructs for retention of suspected functions or activities

  • Compare activity levels to identify essential regions for function

• Structural studies:

  • Scale up production of well-expressed constructs in appropriate host systems

  • Perform structural analysis on truncated constructs that maintain function

This method has been successful for identifying minimal functional domains in other bacterial proteins, enabling more focused structural and functional studies .

What controls should be included when performing functional assays with YidX?

When designing functional assays for an uncharacterized protein like YidX, comprehensive controls are essential to ensure reliable and interpretable results:

• Positive controls:

  • Well-characterized proteins with similar predicted functions or domains

  • Known interaction partners from the same biological pathway (if available)

• Negative controls:

  • Heat-denatured YidX protein to control for non-specific effects

  • Buffer-only conditions to establish baseline measurements

  • Unrelated proteins with similar physical properties (size, charge, etc.)

• Expression and tag controls:

  • Empty vector expressions to control for host cell proteins

  • Tag-only constructs to identify tag-mediated artifacts

  • Alternative tag placements (N-terminal vs. C-terminal) to assess tag interference

• Mutational controls:

  • Conservative substitutions to assess specificity of critical residues

  • Catalytic site mutations (if predicted) to confirm enzymatic mechanism

  • Alanine scanning of predicted interaction interfaces

• Concentration-dependent controls:

  • Titration series to establish dose-response relationships

  • Substrate saturation curves if enzymatic activity is detected

• Environmental controls:

  • pH, temperature, and ionic strength variations to determine optimal conditions

  • Presence/absence of potential cofactors or metal ions

Implementation of these controls provides a robust framework for interpreting results and distinguishing true functional properties from experimental artifacts, which is particularly important for uncharacterized proteins where function must be established de novo.

What are the optimal conditions for expressing soluble YidX in Escherichia coli?

Optimizing expression conditions for soluble YidX in E. coli requires systematic testing of multiple parameters:

• Strain selection:

  • BL21(DE3) for standard high-level expression

  • Origami or SHuffle strains for proteins requiring disulfide bond formation

  • Rosetta strains for proteins with rare codon usage

• Expression vector considerations:

  • Use vectors with tunable promoters like rhaPBAD for dose-dependent expression

  • Consider vectors with solubility-enhancing fusion partners (MBP, SUMO, TrxA)

  • Include appropriate affinity tags (His-tag has been successfully used for YidX)

• Induction parameters optimization:

• Co-expression strategies:

  • Consider co-expression of chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

  • For potential membrane association, co-express membrane integration factors

• Lysis optimization:

  • Test various lysis buffers (varying pH 7.0-8.5, salt 150-500 mM NaCl)

  • Include mild detergents if membrane association is suspected

  • Add protease inhibitors to prevent degradation

• Small-scale expression tests:

  • Perform small-scale expression tests (5-10 mL cultures)

  • Analyze soluble and insoluble fractions by SDS-PAGE

  • Select conditions with highest soluble:insoluble ratio

These optimized conditions have been successfully applied to similar uncharacterized bacterial proteins and can serve as a starting point for YidX expression .

What purification strategy yields the highest purity of Recombinant YidX protein?

A multi-step purification strategy is recommended to achieve high purity of Recombinant YidX:

• Initial capture using affinity chromatography:

  • For His-tagged YidX, use immobilized metal affinity chromatography (IMAC)

  • Load clarified lysate on Ni-NTA or TALON resin

  • Wash extensively with buffer containing 20 mM imidazole to remove non-specific binding proteins

  • Elute with buffer containing 250-500 mM imidazole

• Intermediate purification:

  • Ion exchange chromatography based on YidX's theoretical pI

  • Anion exchange (e.g., Q-Sepharose) if pI < 7.0

  • Cation exchange (e.g., SP-Sepharose) if pI > 7.0

• Polishing step:

  • Size exclusion chromatography (SEC) using Superdex 200 to separate oligomeric states and remove aggregates

  • Run in buffer containing 20 mM HEPES pH 7.5, 150 mM NaCl

• Quality control assessment:

  • SDS-PAGE analysis of final purified protein (>95% purity)

  • Western blot confirmation of identity

  • Mass spectrometry to confirm molecular weight and sequence

  • Dynamic light scattering to assess homogeneity

• Optional tag removal:

  • If required for functional studies, cleave affinity tag using appropriate protease

  • Perform reverse IMAC to separate cleaved protein from tag and protease

  • Confirm tag removal by mass spectrometry or Western blot

This purification workflow typically yields protein of >95% purity suitable for structural and functional studies. The final yield from 1L of E. coli culture would typically be 5-15 mg of purified YidX protein.

How can protein refolding be optimized if YidX forms inclusion bodies?

If YidX forms inclusion bodies despite optimization of expression conditions, implementing a systematic refolding strategy is necessary:

• Inclusion body isolation and washing:

  • Harvest cells and lyse in buffer containing 50 mM Tris-HCl pH 8.0, 100 mM NaCl, 1 mM EDTA, and 0.1% Triton X-100

  • Collect inclusion bodies by centrifugation (10,000×g, 10 min)

  • Wash repeatedly with buffer containing decreasing concentrations of urea (2-0 M) to remove contaminants

• Solubilization of inclusion bodies:

  • Solubilize in denaturing buffer (8 M urea or 6 M guanidine hydrochloride, 50 mM Tris-HCl pH 8.0, 1 mM DTT)

  • Clarify by centrifugation (20,000×g, 30 min) to remove insoluble material

  • For His-tagged YidX, perform IMAC purification under denaturing conditions

• Refolding optimization using genetic algorithm approach:

  • Implement a genetic algorithm (GA) to efficiently screen and optimize refolding conditions

  • Start with 22 variations of refolding conditions in the first generation

  • Evaluate success based on refolding yields and/or enzymatic activity

  • Select the most effective conditions for the next generation

  • Continue optimization for several generations until no further improvement is observed

• Refolding parameter space to explore:

• Refolding methods:

  • Dilution: Rapidly dilute denatured protein into refolding buffer (final concentration 5-10 μg/mL)

  • Dialysis: Gradually remove denaturant by dialysis against decreasing concentrations

  • On-column: Bind denatured protein to affinity column and refold by gradual denaturant removal

This genetic algorithm approach has achieved 74-100% refolding yields for structurally diverse proteins and can be effectively applied to optimize YidX refolding conditions .

How can hydrogen-deuterium exchange mass spectrometry (HDX-MS) be applied to analyze YidX structure?

HDX-MS provides valuable insights into the structural dynamics and domain organization of uncharacterized proteins like YidX:

• Experimental setup:

  • Expose purified YidX to deuterium oxide (D₂O) buffer for various time intervals (10 sec to 24 hours)

  • Quench the exchange reaction with cold acidic buffer (pH 2.5)

  • Digest with pepsin to generate peptide fragments

  • Analyze by liquid chromatography-mass spectrometry (LC-MS)

• Data interpretation for domain identification:

  • Regions with low deuteration rates (protected regions) indicate well-structured domains

  • Rapid deuteration indicates flexible or disordered regions

  • Gradual transitions in deuteration patterns can identify domain boundaries

• Application to YidX construct design:

  • Based on the amino acid sequence of YidX, predict potential domain organization

  • Use HDX-MS to confirm these predictions and identify stable domains

  • For YidX, focus on regions following the signal peptide (after residue 20) where deuteration rapidly decreases, indicating the beginning of well-structured regions

  • Design expression constructs that align with domain boundaries identified by HDX-MS

• Data representation and analysis:

• Integration with other structural techniques:

  • Combine HDX-MS data with secondary structure predictions

  • Validate domain predictions with limited proteolysis

  • Use insights to design crystallization constructs

This approach has been successfully used to identify minimal constructs for crystallization of challenging eukaryotic proteins and can be adapted for YidX structural characterization .

How can contradiction analysis be applied to resolve conflicting experimental data about YidX function?

When research on uncharacterized proteins like YidX produces contradictory results, systematic contradiction analysis can help resolve discrepancies:

• Validator approach for contradiction resolution:

  • Implement a validator framework to assess information consistency

  • Design experiments specifically to test contradictory claims

  • Use statistical methods to quantify confidence in competing hypotheses

  • Apply Bayesian approaches to update confidence based on new evidence

• Case application to YidX characterization:

  • If contradictory localization data exists (e.g., membrane vs. cytoplasmic), systematically test with different tags and detection methods

  • For conflicting functional assignments, design assays that can simultaneously test multiple hypotheses

  • When expression conditions produce variable results, implement factorial design experiments to identify interacting variables

• Documentation and reporting:

  • Maintain comprehensive records of all experimental conditions

  • Document details that might affect reproducibility (reagent sources, equipment settings, environmental conditions)

  • Report both supporting and contradicting evidence in publications

What approaches can identify potential interaction partners of YidX?

Identifying interaction partners is crucial for understanding the function of uncharacterized proteins like YidX. Multiple complementary approaches should be employed:

• Affinity purification coupled with mass spectrometry (AP-MS):

  • Express tagged YidX in its native organism (E. coli or Shigella flexneri)

  • Perform gentle lysis to preserve protein-protein interactions

  • Capture YidX complexes using affinity chromatography

  • Identify co-purifying proteins by mass spectrometry

  • Implement appropriate controls (tag-only, unrelated protein) to filter non-specific interactions

• Bacterial two-hybrid (B2H) screening:

  • Clone YidX into B2H bait vectors

  • Screen against genomic library or candidate proteins

  • Validate positive interactions with reciprocal tests

  • Quantify interaction strength using reporter gene assays

• Cross-linking mass spectrometry (XL-MS):

  • Treat purified YidX or cellular lysates with chemical cross-linkers

  • Digest cross-linked samples and enrich for cross-linked peptides

  • Identify interaction partners and interfaces by mass spectrometry

  • Map interaction sites to the primary sequence and structural models

• Co-immunoprecipitation validation:

  • Generate antibodies against YidX or use tag-based detection

  • Immunoprecipitate YidX from cellular lysates

  • Detect co-precipitating proteins by Western blot

  • Confirm specificity with knockout controls and competition assays

• Functional validation experiments:

  • Perform knockout/knockdown of identified partners to observe phenotypic effects

  • Test for functional complementation between YidX and partner mutants

  • Analyze subcellular co-localization by fluorescence microscopy

  • Reconstitute interactions with purified components in vitro

• Data analysis and network construction:

This multi-method approach increases confidence in true interaction partners while reducing false positives, providing a more comprehensive understanding of YidX's biological role through its protein interaction network.

How can adaptive targeted experimental design be implemented to optimize YidX functional characterization?

Implementing adaptive targeted experimental design can significantly enhance the efficiency and effectiveness of YidX characterization:

• Theoretical framework for adaptive experimentation:

  • Utilize the Tempered Thompson Algorithm within a hierarchical Bayesian model

  • Balance the competing goals of precise treatment effect estimation and participant welfare

  • Implement a lower bound (γ) on assignment probabilities to ensure learning about suboptimal treatments

• Application to YidX characterization:

  • Define clear experimental outcomes (e.g., protein solubility, stability, activity)

  • Identify key experimental variables (expression conditions, buffer components, assay parameters)

  • Divide samples into appropriate strata based on experimental conditions

• Experimental implementation:

• Adaptive optimization for YidX expression:

  • Start with broad screening of expression hosts, vectors, and conditions

  • Update probability distributions of success for each condition combination

  • Weight subsequent experiments toward conditions showing early success

  • Maintain minimum testing of alternative conditions to avoid missing optima

  • Progressively narrow experimental space around successful conditions

• Implementation considerations:

  • Use appropriate surrogate outcomes for rapid feedback cycles

  • Balance exploration (testing new conditions) and exploitation (refining successful conditions)

  • Adjust the lower bound (γ) based on experimental costs and information value

  • Document all decision points in the adaptive process for reproducibility

This approach has been successfully applied in field experiments and can be adapted to optimize laboratory procedures for YidX characterization, potentially reducing the number of experiments needed to identify optimal conditions by 20-30% compared to traditional fixed experimental designs .

What computational methods can predict potential functions of YidX based on limited experimental data?

When experimental data on YidX is limited, computational approaches can provide valuable insights into potential functions:

• Sequence-based function prediction:

  • Position-Specific Iterative BLAST (PSI-BLAST) to detect remote homologs

  • Profile Hidden Markov Models (HMMs) to identify conserved domains

  • Analysis of genomic context and gene neighborhood conservation

  • Coevolution analysis to identify functionally linked proteins

• Structural prediction and analysis:

  • AlphaFold2 or RoseTTAFold for ab initio structure prediction

  • Structural alignment against known protein structures

  • Binding site prediction using CASTp, GHECOM, or SiteMap

  • Molecular dynamics simulations to identify stable conformations

• Integration of experimental and computational data:

  • Incorporate HDX-MS data to validate structural predictions

  • Use limited proteolysis results to confirm domain boundaries

  • Validate predicted binding sites with mutagenesis experiments

  • Cross-reference with transcriptomic data to identify expression patterns

• Machine learning approaches:

• Function prediction workflow for YidX:

  • Generate multiple sequence alignment of YidX homologs

  • Identify conserved residues and predict functional motifs

  • Analyze structural prediction for potential active/binding sites

  • Integrate with available experimental data

  • Formulate testable hypotheses based on computational predictions

• Experimental validation strategies:

  • Design targeted experiments to test top computational predictions

  • Prioritize experiments based on prediction confidence scores

  • Implement feedback loops to refine computational models

This integrated computational-experimental approach has successfully identified functions of previously uncharacterized proteins, including transcription factors in E. coli , and provides a robust framework for generating testable hypotheses about YidX function.

How can CRISPR-based approaches be applied to investigate the in vivo function of YidX?

CRISPR-based technologies offer powerful tools for investigating the in vivo function of uncharacterized proteins like YidX:

• CRISPR interference (CRISPRi) for gene knockdown:

  • Design sgRNAs targeting the promoter or early coding region of the yidX gene

  • Express dCas9 (catalytically inactive Cas9) to block transcription without DNA cleavage

  • Create inducible CRISPRi systems for temporal control of knockdown

  • Quantify knockdown efficiency using RT-qPCR

  • Assess phenotypic consequences across various growth conditions

• CRISPR knockout strategies:

  • Design sgRNAs targeting the yidX coding sequence

  • Implement λ-Red recombineering for efficient gene deletion

  • Confirm knockout by PCR and sequencing

  • Perform comprehensive phenotypic analysis of the knockout strain

  • Conduct complementation tests with wild-type and mutant versions

• CRISPR-based tagging for localization and interaction studies:

  • Design homology-directed repair templates with fluorescent protein or affinity tags

  • Generate C-terminal or N-terminal fusions at the endogenous locus

  • Visualize subcellular localization under various conditions

  • Perform IP-MS with endogenously tagged YidX to identify interaction partners

• CRISPR scanning mutagenesis:

  • Create a library of sgRNAs tiling across the yidX gene

  • Induce Cas9 cleavage and non-homologous end joining repair

  • Screen for phenotypic changes to identify functionally important regions

  • Sequence mutants to correlate mutations with phenotypes

• Experimental design considerations:

• Integration with other experimental approaches:

  • Combine with RNA-seq to identify transcriptional changes upon YidX depletion

  • Integrate with metabolomic profiling to detect metabolic pathway disruptions

  • Couple with proteomics to identify protein abundance changes

These CRISPR-based approaches provide a comprehensive toolkit for investigating YidX function in its native cellular context, generating insights that complement in vitro biochemical and structural studies.

How should experimental data for YidX characterization be organized and presented?

Proper organization and presentation of experimental data are crucial for effective YidX characterization:

• Data table design principles:

  • Clearly identify independent and dependent variables for each experiment7

  • Use consistent units and formatting across related experiments7

  • Include appropriate technical and biological replicates

  • Calculate and present statistical measures (mean, standard deviation, p-values)

• Example data table for YidX expression optimization:

• Graphical representation guidelines:

  • Select appropriate chart types based on data characteristics

  • Bar charts or column graphs for comparing discrete categories

  • Line graphs for showing trends over continuous variables

  • Scatter plots for correlation analysis

  • Include error bars representing standard deviation or standard error

  • Use consistent color schemes and formatting across related figures

• Comprehensive documentation requirements:

  • Detailed materials and methods section with sufficient information for reproducibility

  • Complete description of experimental conditions, reagents, and equipment

  • Explicit documentation of any deviations from standard protocols

  • Raw data preservation in appropriate formats (both processed and unprocessed)

  • Inclusion of negative and positive controls in all data presentations

• Statistical analysis practices:

  • Select appropriate statistical tests based on data distribution and experimental design

  • Report all statistical parameters (test used, n-values, p-values, confidence intervals)

  • Use multiple comparison corrections when performing multiple tests

  • Validate assumptions underlying statistical tests

Following these guidelines ensures that experimental data on YidX characterization is presented in a clear, comprehensive, and reproducible manner, facilitating interpretation and comparison across different studies7.

What statistical approaches are most appropriate for analyzing YidX functional assay data?

Selecting appropriate statistical methods is essential for robust analysis of YidX functional data:

• Exploratory data analysis:

  • Assess data distribution using histograms and Q-Q plots

  • Check for outliers using box plots and z-scores

  • Evaluate homogeneity of variance with Levene's test

  • Determine appropriate transformation if needed (log, square root, etc.)

• Statistical method selection based on experimental design:

• Advanced statistical approaches for complex data:

  • Bayesian hierarchical modeling for incorporating prior knowledge

  • Bootstrap methods for robust confidence intervals

  • Permutation tests for non-parametric inference

  • False discovery rate control for multiple comparisons

• Application to specific YidX assays:

  • For protein-protein interaction strength analysis: Curve fitting with appropriate binding models

  • For activity assays: Michaelis-Menten kinetics analysis with confidence intervals

  • For stability measurements: Survival analysis methods for time-to-event data

  • For structural studies: Clustering and dimension reduction techniques

• Reporting standards:

  • Clearly state null and alternative hypotheses

  • Report effect sizes alongside p-values

  • Include confidence intervals to indicate precision

  • Disclose all statistical tests performed, including those with non-significant results

• Reproducibility considerations:

  • Document complete analysis workflow in script format (R, Python)

  • Record all parameters and random seeds

  • Provide raw data alongside processed results

  • Use version control for analysis code

How can contradictions in experimental results about YidX be systematically resolved?

Resolving contradictions in experimental results requires a structured approach: