Recombinant Uncharacterized protein ypfJ (ypfJ)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Proteins

Recombinant proteins are produced through genetic engineering techniques where a gene encoding a specific protein is inserted into an expression vector, which is then introduced into a host organism such as bacteria, yeast, or mammalian cells. These proteins can be used for various applications, including research, diagnostics, and therapeutics.

Expression and Purification of Recombinant Proteins

Recombinant proteins can be expressed in various hosts, each offering different advantages:

  • E. coli: Offers high yields and rapid production but may lack post-translational modifications.

  • Yeast: Provides better yields than E. coli for some proteins and can perform some post-translational modifications.

  • Insect Cells with Baculovirus: Useful for producing proteins that require complex post-translational modifications.

  • Mammalian Cells: Ideal for proteins needing extensive post-translational modifications for proper folding and activity .

Characterization of Uncharacterized Proteins

Uncharacterized proteins, like ypfJ, are those whose functions or roles within biological systems are not yet fully understood. Characterization involves determining their structure, function, and interactions with other molecules. Techniques such as mass spectrometry, chromatography, and bioinformatics tools are used to analyze these proteins.

Research Findings on Uncharacterized Proteins

While specific data on ypfJ is not available, research on other uncharacterized proteins often involves:

  • Bioinformatics Analysis: Predicting protein structure and potential functions based on sequence homology.

  • Experimental Techniques: Expression and purification of the protein followed by biochemical assays to determine its activity.

Data Tables for Recombinant Protein Expression

Given the lack of specific data on ypfJ, here is a general table illustrating the expression systems for recombinant proteins:

Host SystemAdvantagesDisadvantages
E. coliHigh yield, rapid productionLimited post-translational modifications
YeastBetter yield than E. coli for some proteins, some post-translational modificationsCan be slower than E. coli
Insect CellsComplex post-translational modificationsMore expensive and complex setup
Mammalian CellsExtensive post-translational modificationsHigh cost, complex setup

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
ypfJ; c3003; Uncharacterized protein YpfJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Target Names
ypfJ
Target Protein Sequence
MRWQGRRESDNVEDRRNSSGGPSMGGPGFRLPSGKGGLILLIVVLVAGYYGVDLTGLMTG QPVSQQQSTRSISPNEDEAAKFTSVILATTEDTWGQQFEKMGKTYQQPKLVMYRGMTRTG CGAGQSIMGPFYCPADGTVYIDLSFYDDMKDKLGADGDFAQGYVIAHEVGHHVQKLLGIE PKVRQLQQNATQAEVNRLSVRMELQADCFAGVWGHSMQQQGVLETGDLEEALNAAQAIGD DRLQQQSQGRVVPDSFTHGTSQQRYSWFKRGFDSGDPAQCNTFGKSI
Uniprot No.

Target Background

Database Links

KEGG: ecc:c3003

STRING: 199310.c3003

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the ypfJ protein and why is it classified as "uncharacterized"?

The ypfJ protein is classified as "uncharacterized" because its precise biological function, structural characteristics, and biochemical properties have not been fully elucidated through experimental validation. Uncharacterized proteins are typically identified through genomic sequencing and computational prediction methods, but lack experimental confirmation of their functions. When approaching research on ypfJ, it's important to begin with sequence analysis using bioinformatics tools to identify potential domains, structural motifs, and homology to characterized proteins. This preliminary analysis provides a foundation for experimental design and hypotheses generation.

What expression systems are most suitable for producing recombinant ypfJ protein?

Human cell-based expression systems offer significant advantages for recombinant expression of uncharacterized human proteins like ypfJ. HEK293F suspension cultures represent an optimal system as they provide the correct translation machinery and chaperones for proper protein folding and post-translational modifications. Research has demonstrated that using a YFP fusion-tag system with HEK293F cells can generate high yields of purified recombinant proteins (>10 mg/L of culture using transient expression) . This approach enables direct visualization of expression and fluorescence-based selection of high-expressing clones. For ypfJ specifically, comparing bacterial (E. coli) and mammalian expression systems would be advisable to determine which preserves the protein's native conformation and potential activity.

How can I determine if my ypfJ protein is correctly folded after expression?

Assessment of proper protein folding requires multiple complementary approaches. First, analyze the protein's thermal stability using differential scanning fluorimetry (DSF) or circular dichroism (CD) spectroscopy to determine if it exhibits characteristic melting curves. Second, employ size exclusion chromatography to assess whether the protein exists predominantly as a monomer versus forming aggregates, which often indicate improper folding. Third, if structural predictions suggest the presence of disulfide bonds, perform non-reducing and reducing SDS-PAGE to verify their formation. Finally, functional assays based on bioinformatic predictions of potential activities should be designed to test if the protein demonstrates expected biochemical properties.

What considerations are important when designing experiments to characterize ypfJ?

Designing experiments for an uncharacterized protein requires rigorous adherence to experimental design principles. Begin by clearly defining your variables: the independent variables (e.g., expression conditions, buffer compositions, potential binding partners) and dependent variables (e.g., protein yield, stability, activity) . Formulate specific, testable hypotheses about ypfJ's potential function based on bioinformatic analyses. Control for extraneous variables by maintaining consistent experimental conditions and including appropriate negative and positive controls. Because ypfJ is uncharacterized, it's crucial to design parallel approaches that can test multiple potential functions simultaneously. Document all experimental parameters meticulously to ensure reproducibility, particularly important when working with proteins of unknown function.

How should I approach selecting fusion tags for recombinant ypfJ expression and purification?

Fusion tag selection significantly impacts expression, solubility, and purification efficiency of uncharacterized proteins. For ypfJ, a dual-function tag like YFP offers several advantages: it enables direct visualization of expression, fluorescence-based sorting of high-expressing cells, and efficient purification using anti-GFP/YFP nanobodies . This approach has demonstrated success with large human proteins, yielding >10 mg/L using transient expression. Alternative options include:

TagSizeAdvantagesLimitationsRecommended Use Case
His66 aaSmall size, efficient IMAC purificationPotential interference with metal-binding studiesInitial screening
GST26 kDaEnhanced solubility, affinity purificationLarge size may affect functionChallenging solubility cases
MBP42 kDaSignificant solubility enhancementLarge sizeHighly insoluble proteins
YFP/GFP27 kDaVisual tracking, high-affinity purificationSize, potential dimerizationExpression optimization, localization studies

Select a tag system that allows tag removal with site-specific proteases if functional studies are planned, as tags can potentially interfere with protein activity and structural studies.

What purification strategy is most effective for recombinant ypfJ?

A multi-step purification strategy is recommended for ypfJ to achieve high purity and homogeneity. If using the YFP-fusion approach, begin with high-stringency affinity purification using GFP/YFP nanobody supports, which provides exceptional specificity . Follow with size exclusion chromatography to separate monomeric protein from aggregates and remove potential contaminants. For further purification, ion exchange chromatography can be employed based on the predicted isoelectric point of ypfJ. Throughout the purification process, monitor protein quality using SDS-PAGE and Western blotting. Consider optimizing buffer conditions (pH, salt concentration, additives) empirically to enhance stability during purification. Document protein yield and purity at each step to identify potential bottlenecks in the purification workflow.

How can I develop functional assays for ypfJ when its function is unknown?

Developing functional assays for uncharacterized proteins requires a systematic approach based on bioinformatic predictions and iterative experimental testing. Begin with comprehensive sequence analysis to identify conserved domains and structural motifs that might suggest biochemical functions. Design activity assays for each predicted function class (e.g., enzymatic, binding, structural). For enzymatic activity, test for common activities (hydrolase, transferase, etc.) using general substrate panels. For binding interactions, employ protein-protein interaction methods such as pull-downs, surface plasmon resonance, or yeast two-hybrid screening with predicted interacting partners. Consider broader approaches like transcriptomics or proteomics following ypfJ overexpression or knockdown to identify affected pathways. Finally, develop cellular phenotype assays based on localization data to observe effects of ypfJ modulation on cellular processes.

How can I determine if post-translational modifications are essential for ypfJ function?

Post-translational modifications (PTMs) often critically influence protein function, particularly relevant for uncharacterized proteins. For ypfJ, begin by using bioinformatic tools to predict potential modification sites (phosphorylation, glycosylation, etc.). Compare ypfJ expressed in prokaryotic systems (lacking most PTMs) versus human cell lines like HEK293F to assess functional differences . Employ mass spectrometry-based proteomics to identify and map actual modifications present on the purified protein. Site-directed mutagenesis of predicted modification sites can directly test their functional importance. Additionally, treat purified protein with specific enzymes that remove modifications (phosphatases, glycosidases, etc.) and assess changes in activity or structure. Finally, examine the protein's interaction with modification-specific binding partners or antibodies to confirm the presence and accessibility of these modifications.

How should I approach data analysis when characterizing an uncharacterized protein like ypfJ?

Data analysis for uncharacterized proteins requires particularly rigorous approaches to avoid confirmation bias or overinterpretation. Implement these methodological steps: First, establish clear baseline measurements and controls for all experiments. Apply appropriate statistical analyses based on experimental design, ensuring statistical power through adequate replication (minimum n=3 for biochemical assays). For complex datasets, employ multivariate analysis techniques to identify patterns across multiple parameters. When comparing ypfJ to characterized proteins, use quantitative similarity metrics rather than qualitative assessments. Validate key findings using orthogonal methods that rely on different principles. Finally, critically evaluate results against the null hypothesis that ypfJ does not possess the function being tested, requiring strong evidence to reject this null hypothesis.

How can I resolve contradictory results when characterizing ypfJ?

Contradictory results are common when investigating uncharacterized proteins and require systematic resolution approaches. First, thoroughly document all experimental conditions where discrepancies occur, examining differences in protein preparations, buffer compositions, and assay conditions. Test whether the contradictions might reflect actual biological phenomena such as substrate specificity, cofactor requirements, or conformational changes. Design controlled experiments that directly test competing hypotheses explaining the contradictions. Consider that ypfJ might possess context-dependent functions that vary based on cellular conditions or interaction partners. Collaborate with researchers using different methodologies to provide independent verification. Finally, report all contradictory results transparently in publications, as these discrepancies often lead to deeper insights about protein function and regulation.

What databases and bioinformatic tools are most useful for analyzing uncharacterized proteins like ypfJ?

A comprehensive bioinformatic analysis workflow is essential for guiding experimental work on uncharacterized proteins:

Analysis TypeRecommended ToolsPurpose
Sequence HomologyBLAST, HHpred, HMMERIdentify distant relatives with known functions
Domain PredictionInterPro, SMART, PfamIdentify functional domains and motifs
Structural PredictionAlphaFold, RoseTTAFoldGenerate 3D structural models
PTM PredictionNetPhos, NetOGlyc, NetNGlycPredict modification sites
Protein-Protein InteractionsSTRING, BioGRIDPredict potential interaction partners
Subcellular LocalizationDeepLoc, PSORTPredict cellular compartment
Functional NetworksGeneMANIA, FunCoupPlace protein in functional context

Integrate results from multiple tools to build consensus predictions, as each tool has specific strengths and limitations. Regularly update analyses as new data becomes available and databases are expanded.

How can I improve low expression yields of recombinant ypfJ?

Low expression yields are a common challenge with uncharacterized proteins. Implement this systematic optimization strategy: First, test multiple expression systems in parallel (HEK293F, E. coli, insect cells) to identify the most promising host . Within each system, optimize expression conditions including temperature, induction parameters, and culture media formulations. Consider codon optimization of the ypfJ sequence for your expression host. For mammalian expression, FACS-based selection of high-expressing clones using fluorescent fusion tags can significantly increase yields . If aggregation occurs, co-express molecular chaperones or fuse with solubility-enhancing tags like MBP. For secreted expression, optimize signal peptides for efficiency. Document all optimization attempts systematically to identify patterns that might indicate specific requirements for successful expression.

What strategies can overcome protein aggregation during ypfJ purification?

Protein aggregation during purification requires a multi-faceted approach. Begin by optimizing lysis conditions to minimize initial aggregation - test various detergents, reducing agents, and protease inhibitors. During purification, maintain consistently cold temperatures (4°C) and consider adding stabilizing agents such as glycerol (5-10%), low concentrations of arginine (50-100 mM), or specific cofactors predicted to bind ypfJ. Perform buffer screening experiments testing different pH values, salt concentrations, and additives to identify optimal stability conditions. If aggregation persists, consider removing predicted disordered regions through construct design or adding fusion partners known to enhance solubility. Size exclusion chromatography can separate aggregated from properly folded protein. Finally, implement quality control steps like dynamic light scattering to confirm monodispersity of the final preparation.

How can I validate antibodies against an uncharacterized protein like ypfJ?

Antibody validation is particularly challenging for uncharacterized proteins like ypfJ where typical validation controls may be unavailable. Implement this comprehensive validation strategy: First, express recombinant ypfJ with an orthogonal tag system (e.g., YFP-fusion) and confirm that your antibody recognizes the tagged protein via Western blot . Perform immunoprecipitation followed by mass spectrometry to confirm the antibody pulls down the correct protein. Test antibody specificity using CRISPR/Cas9 knockout cell lines, where the antibody signal should disappear in knockout samples. For polyclonal antibodies, affinity-purify against recombinant ypfJ to increase specificity. Validate in multiple applications (Western blot, immunofluorescence, ChIP) as performance can vary between applications. Document precise experimental conditions where the antibody performs reliably, including dilutions, incubation times, and buffer compositions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.