Recombinant Uncharacterized protein yqjD (yqjD)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

Recombinant Uncharacterized Protein YqjD (yqjD) is a laboratory-produced version of the Escherichia coli protein encoded by the yqjD gene. Originally classified as a hypothetical protein due to limited functional data, recent studies have elucidated its role as an inner membrane-associated ribosome-binding protein critical during the bacterial stationary phase. The recombinant form is widely used in biochemical assays to study its interactions with ribosomes, membrane localization, and potential regulatory roles in stress responses .

Key Features

CharacteristicDescription
Protein Length101 amino acids (MW: ~11.05 kDa)
Sequence MotifsN-terminal ribosome-binding domain; C-terminal transmembrane helix (residues 77–98)
Expression RegulationInduced during stationary phase via RpoS (σS) transcription factor
ParalogsElaB, YgaM (structurally similar but distinct functional roles)

Primary Structure and Localization

YqjD contains a transmembrane helix in its C-terminal region, anchoring it to the inner membrane . The N-terminal domain facilitates binding to the 30S subunit of 70S and 100S ribosomes, suggesting a role in ribosome stabilization or inactivation .

Key Mechanisms

  • N-Terminal Binding: Required for ribosome interaction; truncation abolishes inhibitory effects .

  • Membrane Tethering: C-terminal transmembrane domain enhances ribosome-membrane localization .

  • Regulatory Control: RpoS-dependent expression links YqjD activity to nutrient deprivation and oxidative stress .

Production and Purification

Recombinant YqjD is produced in E. coli or yeast systems, often with N-terminal His-tags for affinity chromatography .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please contact your local distributor.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yqjD; SF3141; S3349; Uncharacterized protein YqjD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Shigella flexneri
Target Names
yqjD
Target Protein Sequence
MSKEHTTEHLRAELKSLSDTLEEVLSSSGEKSKEELSKIRSKAEQALKQSRYRLGETGDA IAKQTRVAAARADEYVRENPWTGVGIGAAIGVVLGVLLSRR
Uniprot No.

Target Background

Database Links

KEGG: sfl:SF3141

Protein Families
ElaB/YgaM/YqjD family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is YqjD and what is its cellular localization?

YqjD is a small protein (101 amino acids, molecular weight of 11,052 Da, pI 9.1) found in Escherichia coli that functions as an inner membrane and ribosome-binding protein. It contains a transmembrane motif in its C-terminal region that anchors it to the inner bacterial membrane, while its N-terminal region associates with ribosomes. YqjD is predominantly expressed during the stationary growth phase of bacterial cultures, suggesting a role in adaptation to nutrient limitation or stress conditions . The protein belongs to a class of C-tail anchored membrane proteins that appear to play regulatory roles in translation during specific growth phases.

How is YqjD expression regulated in E. coli?

YqjD expression is primarily regulated by the stress response sigma factor RpoS (σs), which controls the transcription of stationary-phase-specific genes . According to experimental data, YqjD first becomes detectable after approximately 3 hours of growth (at OD600 = 3.0), and its levels remain relatively constant for up to 12 hours (OD600 ~ 5.0) . This expression pattern aligns with the transition from late exponential to early stationary phase of bacterial growth, indicating that YqjD synthesis is triggered by specific physiological conditions associated with reduced growth rates or nutrient limitation.

What experimental approaches are used to study YqjD-ribosome interactions?

Researchers employ several complementary techniques to investigate YqjD-ribosome interactions:

  • In vitro transcription/translation systems: Using purified cell extracts (cytosolic translation factors) and purified ribosomes to assess the effect of YqjD on protein synthesis .

  • Site-directed cross-linking: The UV-sensitive phenylalanine derivative para-benzoyl-L-phenylalanine (pBpa) is site-specifically inserted at key positions in YqjD using amber-suppressor tRNA and cognate tRNA synthetase. Upon UV exposure, cross-links form between YqjD and interacting proteins, which can then be identified .

  • Sucrose gradient centrifugation: This technique is used to purify ribosomes and analyze their association with YqjD under different growth conditions .

  • Two-dimensional gel electrophoresis: This method has been employed to identify proteins, including YqjD, that associate with ribosomes during the stationary phase .

What phenotypic effects result from YqjD overexpression or deletion?

Overexpression of YqjD leads to inhibition of cell growth, similar to the effect observed with ribosome modulation factor (RMF) . This growth inhibition likely results from YqjD's ability to inactivate ribosomes, thereby reducing the cell's translational capacity. Additionally, cells expressing yqjD show hypersensitivity to chloramphenicol, an antibiotic that targets translating ribosomes, being inhibited at concentrations as low as 0.75 μg/ml compared to the typical minimal inhibitory concentration of 20-30 μg/ml . Interestingly, deletion of the yqjD gene (ΔyqjD strain) does not result in increased chloramphenicol resistance, which is likely explained by the surplus of ribosomes over YqjD in E. coli cells .

What is the molecular mechanism by which YqjD inactivates ribosomes?

YqjD inactivates ribosomes by binding to proteins surrounding the ribosomal tunnel exit and potentially protruding into the ribosomal tunnel itself. Cross-linking studies have identified specific interactions between YqjD and ribosomal proteins uL22 and uL23 . These proteins are particularly significant because:

  • They are exposed on the ribosomal surface but also contact the interior of the ribosomal tunnel via β-hairpin loops.

  • uL22, together with uL4, forms a central constriction within the ribosomal tunnel that serves as a binding site for macrolide antibiotics and antimicrobial peptides.

  • The intra-tunnel loop of uL23 is located closer to the tunnel exit and acts as a nascent chain sensor that binds to protein targeting factors SRP and SecA.

YqjD's interaction with these proteins suggests that it may inactivate ribosomes by mimicking antimicrobial peptides or eukaryotic ribosome hibernation factors, potentially by inserting into the ribosomal peptide tunnel . This mechanism appears to primarily target non-translating ribosomes, as demonstrated by YqjD's binding to ribosomes isolated via sucrose-gradient centrifugation, which are almost exclusively non-translating.

How does the structure of YqjD contribute to its function?

The structure-function relationship of YqjD involves several key elements:

  • N-terminal domain: The N-terminus is crucial for ribosome binding and inactivation. Truncation experiments show that gradually deleting N-terminal amino acids diminishes YqjD's ability to prevent protein synthesis in vitro .

  • C-terminal transmembrane domain (TM): Surprisingly, deleting the C-terminal TM significantly reduces ribosome inactivation, even though the in vitro translation assays are performed in the absence of membranes. This indicates that membrane tethering is not directly responsible for impaired translation .

  • Dimerization: The TM domain contains several conserved glycine residues, which are often involved in protein dimerization or oligomerization. YqjD forms stable dimers even under SDS-PAGE conditions, and this dimerization is strictly dependent on the TM domain .

  • Proline residue: A conserved proline residue in YqjD likely creates kinked α-helices that may form cage- or funnel-like structures with reduced topological flexibility, potentially helping to orient multiple N-termini in close proximity to the ribosome .

The ribosome-YqjD interaction appears to be primarily avidity-driven, with each YqjD monomer having relatively low affinity for ribosomes, but high-affinity binding achieved through dimerization. This explains why ΔTM-YqjD, which cannot dimerize effectively, retains some ribosome binding activity but completely fails to inactivate ribosomes .

How can the inhibitory effect of YqjD on translation be quantitatively assessed?

The inhibitory effect of YqjD on translation can be quantitatively assessed using in vitro transcription/translation systems with various readouts:

  • Concentration-dependent inhibition: Adding increasing amounts of purified YqjD to an in vitro system progressively inhibits the synthesis of reporter proteins like mannitol permease (MtlA) .

  • Protein-specific effects: By comparing the inhibition of synthesis of different proteins (e.g., the membrane protein MtlA, the cytosolic protein YchF, and the secretory protein OmpA), researchers can determine whether YqjD's effect is general or specific to certain protein classes. Current data indicate that YqjD inhibits synthesis of all tested proteins, although with slight variations in potency, possibly relating to differences in translation speed due to codon usage or mRNA length .

  • Ribosome concentration dependency: Since YqjD appears to stoichiometrically inactivate ribosomes, the inhibitory effect depends on the ribosome concentration in the assay. At a fixed YqjD concentration (e.g., 30 nM), increasing ribosome concentrations from ~10 nM to ~20 nM gradually overcomes the inhibitory effect . This observation supports a model where YqjD directly binds and inactivates ribosomes in a stoichiometric manner.

The following table summarizes the relationship between ribosome concentration and YqjD inhibitory effect:

Ribosome ConcentrationTranslation without YqjDTranslation with 30 nM YqjD
<10 nMLow-moderateStrongly reduced
~10-15 nMModerate-highGradually increasing
~20 nMSaturatedDetectable
>20 nMSaturatedIncreasing

How does YqjD contribute to bacterial stress response and stationary phase survival?

YqjD likely plays a role in bacterial adaptation to stationary phase conditions by:

  • Ribosome hibernation: By inactivating a portion of the cellular ribosomes during stationary phase, YqjD may help conserve energy when nutrients are scarce. This is supported by the observation that YqjD-expressing cells show hypersensitivity to chloramphenicol, which targets translating ribosomes .

  • Integration with stress response pathways: YqjD expression is regulated by RpoS, the master regulator of the general stress response in E. coli . This places YqjD within a broader network of genes activated under stress conditions.

  • Membrane localization of ribosomes: YqjD may facilitate the localization of inactive ribosomes to the cell membrane during stationary phase, potentially creating spatial organization of translation resources within the cell .

  • Coordination with paralogous proteins: The presence of multiple related proteins (YqjD, ElaB, YgaM) suggests a system with potentially redundant or complementary functions in managing translation during stationary phase. ElaB, like YqjD, can inhibit protein synthesis in vitro, although full inhibition requires higher concentrations than for YqjD .

The importance of these proteins in long-term survival was investigated through growth experiments counting viable cell numbers over extended periods, though the specific outcomes of these experiments are not fully detailed in the provided search results .

What methodological considerations are important for purifying recombinant YqjD?

Purifying recombinant YqjD for functional studies requires careful consideration of several factors:

  • Expression system: Since YqjD is a membrane protein with a C-terminal transmembrane domain, expression systems must be capable of handling membrane proteins, possibly requiring detergents or membrane mimetics.

  • Purification of functional dimers: Given the importance of dimerization for YqjD function, purification protocols should aim to preserve the native dimeric state of the protein. This may involve mild solubilization conditions and appropriate detergent selection.

  • Truncation variants: For structure-function studies, various truncated forms of YqjD have been employed, including:

    • N-terminally truncated variants (ΔN-YqjD): To study the role of the N-terminus in ribosome binding and inactivation .

    • C-terminally truncated variants (ΔTM-YqjD): To investigate the role of the transmembrane domain in dimerization and function .

  • Site-specific incorporation of cross-linkers: For interaction studies, techniques for incorporating para-benzoyl-L-phenylalanine (pBpa) at specific positions (e.g., L10pBpa, I39pBpa) require specialized expression systems with amber suppressor tRNA and cognate tRNA synthetase .

According to the supplier information from the search results, commercial recombinant YqjD is available from CUSABIO TECHNOLOGY LLC, which may provide standardized preparations for research purposes .

How does YqjD compare to known ribosome hibernation factors?

YqjD's mechanism of ribosome inactivation appears to share similarities with both bacterial hibernation factors and antimicrobial peptides:

  • Like established bacterial hibernation factors such as Ribosome Modulation Factor (RMF), YqjD is expressed during stationary phase and can inactivate ribosomes .

  • Unlike most characterized hibernation factors that primarily act by promoting dimerization of 70S ribosomes into 100S ribosomes, YqjD appears to function through direct binding to ribosomal proteins near the peptide exit tunnel .

  • YqjD's apparent ability to reach into the peptide tunnel of the ribosome resembles the mechanism of certain antimicrobial peptides and eukaryotic ribosome hibernation factors .

  • The coordinated expression of YqjD with its paralogs (ElaB and YgaM) suggests a potentially more complex ribosome management system during stationary phase than previously appreciated .

This comparative analysis places YqjD within a broader context of mechanisms for regulating translation in response to changing environmental conditions, representing what may be an alternative or complementary approach to the well-characterized 100S ribosome formation pathway.

What is the significance of YqjD's evolutionary conservation?

The evolutionary significance of YqjD and its paralogs lies in several observations:

  • The presence of two paralogous proteins (ElaB and YgaM) in E. coli suggests gene duplication events followed by potential functional diversification .

  • The conservation of specific structural features across these proteins, such as:

    • The C-terminal transmembrane domain with conserved glycine residues important for dimerization

    • The functionally critical N-terminal region that interacts with ribosomes

    • A conserved proline residue that likely creates kinked α-helices important for function

  • The cross-species distribution of these proteins is not fully characterized in the provided search results, but the description of YqjD as part of a "class of widely distributed C-tail anchored membrane proteins" suggests conservation beyond E. coli .

This conservation pattern suggests that the ribosome hibernation mechanism employed by YqjD represents an important adaptation for bacterial survival under challenging conditions, which has been maintained throughout evolutionary history.

What are promising areas for further investigation of YqjD function?

Based on current knowledge, several promising research directions emerge:

  • Structural studies: Obtaining high-resolution structures of YqjD, both alone and in complex with ribosomes, would provide crucial insights into its mechanism of action. Cryo-electron microscopy would be particularly valuable for visualizing the YqjD-ribosome complex.

  • Dynamics of ribosome binding: Real-time studies of how YqjD interacts with ribosomes during the transition to stationary phase could clarify its physiological role.

  • Interplay with other hibernation factors: Investigating how YqjD functions alongside other known ribosome hibernation factors would provide a more comprehensive understanding of stationary phase adaptation.

  • Functional differences between paralogs: Comparative studies of YqjD, ElaB, and YgaM could reveal whether these proteins have distinct or overlapping functions in ribosome management.

  • Physiological consequences: Further exploration of how YqjD-mediated ribosome inactivation affects bacterial survival under various stress conditions would clarify its biological significance.

  • Potential antimicrobial applications: Given the similarities between YqjD's mechanism and antimicrobial peptides, investigating whether this pathway could be targeted for antimicrobial development represents an intriguing possibility.

What technical challenges must be overcome in YqjD research?

Research on YqjD faces several technical challenges:

  • Membrane protein purification: As a membrane-anchored protein, YqjD presents typical challenges associated with membrane protein purification, including maintaining native conformation and function.

  • Functional reconstitution: Creating systems that accurately reflect the in vivo environment for studying YqjD activity, particularly regarding its membrane association and dimerization.

  • Distinguishing redundant functions: Given the presence of paralogs, determining the specific contribution of YqjD versus ElaB and YgaM requires careful genetic approaches.

  • Temporal regulation: Developing methods to study the dynamics of YqjD action during the transition to stationary phase and under various stress conditions.

  • Structural analysis: Obtaining structural information for a small membrane protein that forms part of a complex with the much larger ribosome presents significant technical difficulties.

Addressing these challenges will require integrating multiple experimental approaches, including genetics, biochemistry, structural biology, and systems biology techniques.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.