Recombinant Uncharacterized protein ZK512.1 (ZK512.1)

What is ZK512.1 and what are its basic structural characteristics?

ZK512.1 is an uncharacterized protein from the nematode Caenorhabditis elegans. Current structural information indicates:

• Amino Acid Sequence (positions 19-240): ATWVKITKPTITWEDMEVSLEGERFFCGEFDSSFTGRYHWRFNGSSILPERTQIHRNQFVFLAGANAIRNQLPGEYECCVRETLGNACYSRMIVVQNRTDNHNIDMTNSTLLLADEGNTYYTMHDVKRVEGVKCTLDGVNVDNFKYPFLGRQTKKTVPYHLKIENIERGGEVNCDLRLHKKEIVQKTFDIRLLRGFISSQLPQFVYLIVFTIIGYILRL

• Molecular Weight: 27,966 Da

• Classification: Transmembrane protein

• Source Organism: Caenorhabditis elegans

As an uncharacterized protein, ZK512.1's specific function remains unknown, which presents both challenges and opportunities for researchers. Current recombinant versions are available with full-length mature protein (19-240 amino acids) , making it accessible for laboratory investigations.

What expression systems are recommended for producing recombinant ZK512.1?

Several expression systems have been successfully used for ZK512.1 production, each with distinct advantages:

E. coli expression has been documented for ZK512.1 with His-tagging , making it a practical starting point for most researchers. When expressing ZK512.1, consider that recent advances in recombinant production suggest that "less is more" - decreasing the pace of exogenous protein synthesis often leads to higher yields of functional protein, particularly for transmembrane proteins .

What are the recommended purification strategies for ZK512.1?

Purification of ZK512.1 typically employs affinity chromatography based on the fusion tag used in expression:

• His-Tagged ZK512.1: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co2+ resins is the primary method .

• Other Available Tags: GST, MBP, FLAG, or other fusion partners can be used for alternative purification strategies .

For transmembrane proteins like ZK512.1, consider these additional purification recommendations:

• Include detergents appropriate for membrane proteins (e.g., mild non-ionic detergents like DDM or CHAPS) in buffer systems

• Consider membrane protein-specific techniques such as styrene-maleic acid lipid particles (SMALPs) for maintaining native lipid environment

• Implement proper refolding protocols if the protein is recovered from inclusion bodies

• Aim for ≥85% purity as determined by SDS-PAGE for most functional studies

The specific purification strategy should be optimized based on the intended downstream application and required purity level (available from ≥80% to ≥95%) .

How should researchers store and handle recombinant ZK512.1?

Proper storage and handling are critical for maintaining ZK512.1 stability and activity:

• Long-term Storage: Store at -20°C or -80°C in buffer containing glycerol (typically 10-25%)

• Working Aliquots: Store at 4°C for up to one week

• Freeze-Thaw Cycles: Avoid repeated freezing and thawing

• Sample Preparation: Briefly centrifuge vials before opening to collect any protein that may be trapped in the cap

• Buffer Considerations: For transmembrane proteins like ZK512.1, consider maintaining an appropriate detergent concentration above the critical micelle concentration in all buffers

These handling precautions will help maintain protein integrity for downstream applications and experimental reproducibility.

What experimental design strategies are most effective for functional characterization of uncharacterized proteins like ZK512.1?

Functional characterization of uncharacterized proteins like ZK512.1 requires a systematic approach combining multiple methodologies:

Systematic Experimental Design Framework:

• Hypothesis Generation:

  • Begin with bioinformatic prediction of potential functions

  • Identify independent variables (protein concentration, interaction partners, environmental conditions)

  • Define clear dependent variables (phenotypic outcomes, binding affinities, enzymatic activities)

• Control Implementation:

  • Include negative controls (e.g., purification tag alone)

  • Use positive controls with known function

  • Account for confounding variables (experimental conditions, batch effects)

• Between-subjects vs. Within-subjects Design:

  • Between-subjects: Different experimental conditions applied to different samples

  • Within-subjects: Same samples subjected to multiple conditions sequentially

• Validation Strategy:

  • Use multiple orthogonal techniques to confirm findings

  • Implement dosage-response experiments

  • Employ genetically modified strains to validate in vivo function

Successful characterization of ZK512.1 would likely involve progressive experiments starting with in silico predictions, followed by in vitro binding studies, and culminating in in vivo functional assays in C. elegans models.

How can researchers use RNA interference (RNAi) to investigate ZK512.1 function in C. elegans?

RNA interference provides a powerful approach for studying ZK512.1 function through targeted gene knockdown:

RNAi Protocol for ZK512.1 Investigation:

• RNAi Construct Design:

  • Design specific dsRNA targeting ZK512.1 sequence

  • Create feeding vector using ZK512.1 cDNA fragment cloned into L4440 vector

  • Transform into HT115(DE3) E. coli strain

• Delivery Methods:

  • Feeding: Culture bacteria expressing dsRNA on NGM plates with IPTG

  • Injection: Direct injection of dsRNA into the gonad

  • Soaking: Immerse worms in dsRNA solution

• Phenotypic Analysis:

  • Monitor for observable phenotypes (Unc, Ste, etc.)

  • Document developmental timing changes

  • Quantify physiological parameters

  • Compare with wild type controls

• Validation:

  • Confirm knockdown efficiency using RT-PCR

  • Rescue experiments with RNAi-resistant constructs

  • Compare with known phenotype databases

Research has shown that RNAi in C. elegans can successfully identify phenotypes based on sequence similarity with relatively high success rates (22% for sterility and 41% for uncoordinated phenotypes) , making this approach particularly valuable for uncharacterized proteins like ZK512.1.

What bioinformatic approaches can predict potential functions of ZK512.1?

A comprehensive bioinformatic workflow can provide valuable insights into potential functions of ZK512.1:

In Silico Characterization Pipeline:

• Sequence-Based Analysis:

  • Homology detection using PSI-BLAST and HHpred

  • Domain prediction using Pfam, SMART, and CDD

  • Secondary structure prediction using PSIPRED

  • Transmembrane topology prediction using TMHMM

• Physicochemical Characterization:

  • Instability index (II) calculation (ZK512.1 likely has II < 40 indicating stability)

  • Theoretical pI determination

  • GRAVY value calculation for hydrophobicity assessment

• Subcellular Localization Prediction:

  • Use PSORTb tool to classify localization (cytoplasmic, membrane, extracellular)

  • SignalP analysis for secretory properties

• Interaction Network Analysis:

  • Apply network generality metrics to identify reliable interactions

  • Implement "guilt by association" principles where partners with low generalities likely share cellular roles

  • Prediction accuracy increases from ~63% to ~79.6% when interactions with generalities of 2 or more are eliminated

These computational approaches provide a foundation for experimental validation and can significantly narrow the potential functional space for uncharacterized proteins like ZK512.1.

What approaches are recommended for studying protein-protein interactions of ZK512.1?

Investigating protein-protein interactions for ZK512.1 requires a multi-faceted approach:

Interaction Discovery and Validation Strategy:

• Yeast Two-Hybrid Screening:

  • Construct bait plasmid containing ZK512.1

  • Screen against C. elegans cDNA library

  • Validate positive interactions with targeted assays

• Co-Immunoprecipitation:

  • Express tagged ZK512.1 in C. elegans or heterologous system

  • Perform pull-down experiments with anti-tag antibodies

  • Identify interacting partners via mass spectrometry

• Proximity Labeling:

  • Generate BioID or APEX2 fusion with ZK512.1

  • Express in C. elegans

  • Identify proximal proteins via streptavidin pull-down and mass spectrometry

• Network Analysis and Filtering:

  • Apply interaction generality measurements to assess reliability

  • Filter interactions based on generality scores

  • Prioritize partners with lower generality scores (more specific interactions)

  • Focus on interactions with proteins of known function to apply "guilt by association" principles

• Bipartite Network Community Detection:

  • Implement algorithms like BiTSC to identify functional modules

  • Generate community structures that reveal functional relationships

This stratified approach helps overcome challenges associated with studying uncharacterized proteins by focusing on the most reliable interaction partners first.

How can transgenic C. elegans models be developed to study ZK512.1 function?

Creating transgenic C. elegans models provides a powerful system for ZK512.1 functional studies:

Transgenic Model Development Protocol:

• Construct Design:

  • Create expression vectors with tissue-specific promoters

  • Include fluorescent protein tags (GFP/mCherry) for visualization

  • Consider temperature-sensitive constructs for conditional expression

• Transformation Methods:

  • Microinjection of DNA constructs into the gonad

  • Bombardment with DNA-coated gold particles

  • Integration into genome using UV irradiation or CRISPR-Cas9

• Strain Validation:

  • PCR verification of transgene integration

  • RT-PCR quantification of expression levels

  • Western blot analysis of protein expression

  • Fluorescence microscopy for localization

• Phenotypic Analysis:

  • Quantify growth and development at different temperatures

  • Analyze motility using automated tracking systems

  • Assess temperature-dependent phenotypes

  • Compare with wild-type controls

• Molecular Characterization:

  • Perform RNA-seq analysis on sorted transgenic cells

  • Use FACS to isolate specific cell populations expressing ZK512.1

  • Apply differential expression analysis to identify affected pathways

Development of temperature-sensitive transgenic strains can be particularly valuable, as demonstrated in other C. elegans models that exhibit temperature-dependent movement deficits .

What methodologies are recommended for transcriptomic analysis of ZK512.1 function?

Transcriptomic analysis provides insights into the broader impact of ZK512.1 on gene expression:

Transcriptomic Analysis Workflow:

• Sample Preparation:

  • Generate comparison groups: ZK512.1 overexpression, knockdown, and control

  • Prepare synchronized L1 larvae populations

  • Perform dissociation protocols optimized for C. elegans

• Cell Isolation:

  • Use DAPI (1 μg/mL) to mark damaged cells

  • Apply FACS sorting with appropriate fluorescent markers

  • Collect 20,000-50,000 cells of interest

  • Process in TRIzol reagent for RNA preservation

• RNA Isolation and Quality Control:

  • Extract RNA using Direct-zol RNA MiniPrep Kit

  • Assess RNA integrity via TapeStation analysis

  • Ensure sufficient RNA concentration (5-100ng total RNA)

• Library Preparation and Sequencing:

  • Construct RNA-seq libraries using low-input protocols

  • Perform paired-end, 150 base-pair sequencing

  • Aim for 3 biological replicates per condition

• Data Analysis:

  • Align reads to C. elegans reference genome using HISAT2

  • Count features using featureCounts

  • Perform differential expression analysis with DESeq2

  • Apply significance thresholds (FDR < 0.05 and log2 fold change > 0.58)

• Functional Annotation:

  • Use DAVID for gene ontology term analysis

  • Perform functional clustering

  • Identify enriched pathways and biological processes

This comprehensive approach enables identification of genes and pathways affected by ZK512.1, providing indirect evidence of its biological function.