Recombinant Uncinocarpus reesii Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
RCF1; AIM31; UREG_02747; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Uncinocarpus reesii (strain UAMH 1704)
Target Names
RCF1
Target Protein Sequence
MSDRPLPSSFDPYNSYLLRILLCSVLPVQFLAVHELITRPIPAGCLATSYALLRAYKSMK AGDSAQLNRMFRFRIYAQAFTLLAGVGGGFYYQAERAQRKELERAVADKKAQAKRDAWLR ELEIRDQEDREWRERHEAVGKAAKEAGNKPKEANLDAPKVPTKESEEAKPTGGILDAVKS LGKEK
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.

Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

Why is Uncinocarpus reesii significant in comparative fungal biology?

Uncinocarpus reesii is a saprotrophic microfungus that grows in soil and on keratinous materials like hair, feathers, and skin . Its scientific importance stems from being the closest non-pathogenic relative to Coccidioides species, which cause serious respiratory infections (coccidioidomycosis or Valley fever).

The evolutionary relationship is supported by multiple lines of evidence:

ParameterComparison ValueSignificance
18S ribosomal gene sequence divergence~0.7%Indicates approximately 20-30 million years of evolutionary distance
Morphological featuresHigh similarityShows close phylogenetic relationship despite differing pathogenicity
Genomic sequence identitySignificant in multiple regionsEnables comparative genomics for pathogenesis studies

This close relationship makes U. reesii an invaluable model organism for comparative studies aimed at understanding the genetic basis of pathogenicity in Coccidioides species .

What expression systems are optimal for producing recombinant AIM31?

Recombinant U. reesii AIM31 has been successfully expressed in several systems, with E. coli being the most commonly reported. The methodological considerations include:

  • E. coli expression system:

    • Advantages: High yield, established protocols, cost-effective

    • Methodology: The full-length protein (1-185 aa) is typically fused to an N-terminal His-tag for purification purposes

    • Purification: Nickel affinity chromatography followed by SDS-PAGE verification

    • Typical purity: Greater than 85-90%

  • Yeast-based expression:

    • Advantages: Post-translational modifications more similar to native protein

    • Applications: Functional studies requiring proper protein folding

  • Storage and handling:

    • Optimal storage: -20°C/-80°C upon receipt, with aliquoting necessary for multiple use

    • Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

    • Reconstitution: In deionized sterile water to 0.1-1.0 mg/mL, with 5-50% glycerol recommended for long-term storage

How can AIM31 contribute to understanding mitochondrial inheritance patterns in disease models?

Recent research on mitochondrial inheritance has revealed important insights into disease mechanisms, particularly in neurodegenerative conditions. Experimental approaches using AIM31 can help elucidate:

  • Homoplasmic vs. heteroplasmic mutations:
    Studies have shown that in conditions like ALS (Amyotrophic Lateral Sclerosis), homoplasmic mutations (affecting the total mitochondrial genome) in respiratory chain components correlate with maternal inheritance patterns . AIM31, as a respiratory chain component, can be studied in similar contexts to understand inheritance mechanisms.

  • Methodological approach:

    • Isolate mitochondrial fractions from tissue samples

    • Analyze AIM31 expression levels and mutations using resequencing microarrays (similar to Affymetrix MitoChip v2.0)

    • Compare homoplasmic and heteroplasmic mutations between patient cohorts

    • Correlate findings with clinical presentations

  • Significance in disease research:
    Research has demonstrated that specific maternally transmitted mitochondrial DNA mutations contribute to disease processes rather than randomly acquired mutations. This contrasts with observations in Alzheimer's and Parkinson's diseases, which show age-dependent accumulation of unspecific mutations .

What experimental design strategies are effective for AIM31 functional characterization?

When designing experiments to investigate AIM31 function, consider these methodological approaches:

  • Blocking design for inter-species comparison:

    • Group organisms (e.g., U. reesii and Coccidioides) into blocks based on phylogenetic relationship

    • Randomly assign treatments within blocks

    • Control for environmental variables to isolate AIM31-specific effects

  • Gene knockout/knockdown studies:

    • CRISPR-Cas9 gene editing to create AIM31-deficient strains

    • Phenotypic analysis focusing on mitochondrial morphology, inheritance patterns, and respiratory function

    • Complementation with wild-type and mutant AIM31 variants to verify observed phenotypes

  • Protein-protein interaction network analysis:

    • Co-immunoprecipitation using His-tagged AIM31

    • Mass spectrometry to identify interaction partners

    • Validation through yeast two-hybrid or bimolecular fluorescence complementation

How can U. reesii AIM31 be applied in comparative pathogenesis research?

The non-pathogenic nature of U. reesii makes it an excellent comparative model for understanding pathogenicity in related Coccidioides species:

  • Genetic transformation approaches:

    • U. reesii can be transformed using methods employed for Coccidioides

    • Protoplast preparation using lysing enzymes, Driselase, and recombinant chitinase 1

    • DNA uptake facilitated by polyethylene glycol and calcium ions

    • Selection on media containing hygromycin B (initially 75 μg/ml, then 100 μg/ml)

  • Heterologous protein expression applications:
    Using U. reesii as an expression system for Coccidioides proteins has been successfully demonstrated with β-glucosidase 2 (BGL2), resulting in:

    • Retention of proper protein glycosylation and antigenicity

    • Significantly reduced biosafety concerns compared to working with BSL-3 Coccidioides

    • Comparable seroreactivity in diagnostic applications (78.8% sensitivity and 87.3% specificity)

  • Comparative genomics workflow:

    • Analyze synteny between AIM31 genomic regions in U. reesii and Coccidioides

    • Identify conserved regulatory elements

    • Perform phylogenetic analysis to understand evolutionary trajectory of AIM31 function

What are common technical challenges in AIM31 protein purification and how can they be addressed?

Researchers often encounter several challenges when working with recombinant AIM31:

  • Protein solubility issues:

    • Problem: AIM31 may form inclusion bodies in E. coli expression systems

    • Solution: Optimize expression temperature (typically lower to 16-18°C), use solubility-enhancing tags, or explore alternative host systems like yeast

  • Protein stability during storage:

    • Problem: Activity loss during freeze-thaw cycles

    • Solution: Store in single-use aliquots with 50% glycerol at -80°C; avoid repeated freeze-thaw cycles

  • Verification of protein functionality:

    • Problem: Ensuring purified protein retains native activity

    • Solution: Employ functional assays specific to respiratory chain complexes, measure mitochondrial membrane potential in reconstituted systems

How can researchers design efficient experiments to investigate AIM31's role in mitochondrial inheritance?

When studying AIM31's role in mitochondrial inheritance, consider these methodological approaches:

  • Gene replacement experiments:

    • Generate chimeric constructs where U. reesii AIM31 domains are replaced with corresponding Coccidioides regions

    • Assess the effect on mitochondrial morphology, distribution, and inheritance

    • Use fluorescence microscopy with mitochondrial markers to track inheritance patterns

  • Randomized controlled design principles:

    • Control: Compare treatment of interest to a control group

    • Randomize: Randomly assign subjects to treatments

    • Replicate: Collect sufficiently large samples or replicate the entire study

    • Block: Group subjects into blocks based on variables known to affect the response

  • Data analysis workflow:

    • Account for potential confounding variables

    • Use appropriate statistical methods for analyzing mitochondrial inheritance patterns

    • Consider multiple testing corrections in genomic comparisons

What emerging technologies could advance our understanding of AIM31 structure-function relationships?

Several cutting-edge approaches show promise for deeper insights into AIM31 biology:

  • Cryo-electron microscopy:

    • Application: Determining high-resolution structures of AIM31 in complex with other mitochondrial proteins

    • Benefit: Reveals molecular interactions at near-atomic resolution without crystal artifacts

  • Genome editing combined with single-cell omics:

    • Application: CRISPR-based editing of AIM31 in combination with single-cell RNA-seq and proteomics

    • Benefit: Reveals cell-to-cell variation in response to AIM31 perturbation

  • Long-read sequencing for mitochondrial heteroplasmy analysis:

    • Application: Characterizing mitochondrial DNA variants in relation to AIM31 function

    • Benefit: Provides more accurate assessment of heteroplasmic variants than short-read technologies

How might comparative studies between U. reesii and Coccidioides AIM31 lead to therapeutic applications?

The non-pathogenic nature of U. reesii combined with its close relationship to pathogenic Coccidioides species creates opportunities for therapeutic development:

  • Drug target identification:

    • Compare AIM31 protein-protein interactions between species

    • Identify interaction partners unique to pathogenic species

    • Target these interactions for drug development

  • Vaccine development platform:

    • U. reesii has been successfully used to express Coccidioides antigens while maintaining proper post-translational modifications

    • Similar approaches could be applied to other fungal pathogens

    • The expression system provides significant biosafety advantages over working with pathogenic organisms directly

  • Diagnostic applications:

    • Recombinant proteins expressed in U. reesii have shown comparable performance to native proteins in diagnostic tests

    • This approach can be expanded to develop rapid diagnostic tools for fungal infections

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.