Recombinant Uncinocarpus reesii High osmolarity signaling protein SHO1 (SHO1)

Shipped with Ice Packs
In Stock

Description

Expression System

SHO1 is produced using a fungal expression system in U. reesii, leveraging its genetic similarity to Coccidioides for authentic post-translational modifications . Key steps include:

  • Vector Design: The pCE plasmid incorporates the C. posadasii HSP60 promoter for temperature-inducible expression and a hygromycin resistance marker (HPH) for selection .

  • Transformation: Protoplasts of U. reesii are transformed with linearized pCE-SHO1 DNA, yielding stable transformants confirmed via PCR and Western blot .

  • Induction: Expression is induced by temperature shifts, yielding soluble, active protein .

Purification and Quality Control

  • Purification: Affinity chromatography using nickel-NTA resins captures the His-tagged protein .

  • Purity: ≥85% (SDS-PAGE) , with optimized storage in Tris-based buffers containing 50% glycerol at -20°C .

  • Activity: Retains chitinolytic and seroreactive properties comparable to native proteins .

Serodiagnostic Assays

SHO1-derived antigens show high diagnostic efficacy:

  • ELISA Performance: 96.1% sensitivity (74/77 patient sera) for detecting coccidioidomycosis .

  • Comparative Advantage: Superior to bacterially expressed homologs in conformational fidelity and antigenicity .

Functional Studies

  • Osmosensing Mechanisms: Used to map signaling pathways in Coccidioides and related fungi .

  • Stress Response Modeling: Provides insights into fungal adaptation to host environments .

Key Research Findings

StudyOutcome
Protein ExpressionU. reesii system yields properly folded, enzymatically active SHO1 without hyperglycosylation .
Diagnostic UtilityRecombinant SHO1 outperforms bacterial analogs in serological tests due to native-like folding .
Genomic ContextPhylogenetic proximity to Coccidioides enables safe study of virulence-associated pathways .

Challenges and Future Directions

  • Scalability: Optimizing yield for large-scale diagnostic use.

  • Functional Variants: Engineering temperature-sensitive mutants for pathway studies.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
SHO1; UREG_03671; High osmolarity signaling protein SHO1; Osmosensor SHO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Uncinocarpus reesii (strain UAMH 1704)
Target Names
SHO1
Target Protein Sequence
MPRIRLDNLFGDPFALASVSISLLAWLIAFVSAIISSIRDSFPPIYWWNLVYMFLCIVGI AYVMATATTHIYSTAVVGYVSAGFAFTTFAADGLLKKQSGSNEAAGAGFILLSIVNVVWI FYFGSSPQSRSRHYIDSFAMHKEQPSYLNPSQMSNHYNNRPDTTVSTQPPQMYTSAQLNG FETSSPYGAPPGPSGASGIGNSQVNLAGTSSNGEAPNEVSPPTEYPYKAKAIYAYEANPD DANEISFTKNEILEVSDVSGRWWQAKKATGETGIAPSNYLILL
Uniprot No.

Target Background

Function
A plasma membrane osmosensor that activates the high osmolarity glycerol (HOG) MAPK signaling pathway in response to hyperosmolarity.
Database Links
Protein Families
SHO1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Uncinocarpus reesii and why is it significant for protein expression?

Uncinocarpus reesii is a non-pathogenic fungus that is morphologically very similar to Coccidioides species, which cause coccidioidomycosis (Valley Fever) in humans. Sequence analysis indicates that U. reesii is one of the closest known relatives of Coccidioides, with the sequence divergence of the 18S ribosomal gene between C. immitis and U. reesii being approximately 0.7%, reflecting approximately 20-30 million years of evolutionary distance .

This close relationship makes U. reesii an ideal candidate for expressing Coccidioides proteins without the biosafety concerns associated with handling pathogenic organisms. U. reesii serves as an effective expression system for recombinant proteins that require eukaryotic post-translational modifications, particularly for proteins from related pathogenic fungi .

How does recombinant U. reesii SHO1 compare to native SHO1 protein?

While specific data comparing recombinant and native U. reesii SHO1 is not directly available in the search results, research on other recombinant proteins expressed in U. reesii provides valuable insights. For example, when the chitinase (Cts1) from Coccidioides posadasii was expressed in U. reesii, the recombinant protein (rCts1 Ur) showed proper folding and glycosylation patterns similar to the native protein .

The recombinant U. reesii SHO1, when expressed using similar systems, would likely maintain proper conformation and post-translational modifications. This is particularly important for membrane proteins like SHO1, where proper folding is critical for function. Unlike bacterial expression systems that often produce misfolded eukaryotic proteins, the U. reesii system allows for appropriate eukaryotic processing .

What expression systems are optimal for producing recombinant U. reesii SHO1?

The optimal expression system for U. reesii SHO1 would likely be similar to the system developed for expressing Coccidioides proteins in U. reesii itself. This approach involves:

  • Constructing a coccidioidal protein expression vector (pCE) containing:

    • A promoter derived from the heat shock protein gene (HSP60) of Coccidioides posadasii

    • A terminator to provide a poly(A) addition site

    • His6-encoding oligonucleotides for C-terminal tagging

    • A hygromycin resistance gene (HPH) for selection

  • Inserting the SHO1 gene without its stop codon into the expression vector

  • Transforming U. reesii protoplasts with the construct

  • Selecting transformants using hygromycin B resistance

  • Inducing protein expression through temperature elevation (heat shock from 25°C to 37°C)

This system would likely produce properly folded and post-translationally modified SHO1 protein with characteristics similar to the native protein.

What are the optimal purification methods for recombinant U. reesii SHO1?

Based on the methodology used for other recombinant proteins expressed in U. reesii, an effective purification protocol would include:

  • Growing the transformed U. reesii culture at 30°C for 3-4 days

  • Inducing protein expression by elevating the temperature to 37°C overnight

  • Collecting culture filtrates (for secreted proteins) or preparing cell lysates (for intracellular/membrane proteins like SHO1)

  • Initial concentration using ammonium sulfate precipitation (90% saturation)

  • Solubilizing the protein precipitate in water

  • Exhaustive dialysis against sterile distilled water

  • Affinity chromatography using nickel columns (leveraging the His6-tag)

  • Verification of protein purity and identity using:

    • SDS-PAGE analysis

    • Western blotting with anti-His-tag antibodies

    • Mass spectrometry (SELDI-TOF) to determine molecular mass and homogeneity

    • Trypsin digestion followed by peptide fingerprinting (MALDI-TOF)

For membrane proteins like SHO1, additional steps including detergent solubilization would likely be necessary to extract the protein from membranes while maintaining its native conformation.

How can researchers validate the functional activity of purified recombinant SHO1?

Validation of functional activity for recombinant SHO1 would require multiple approaches:

  • Structural validation:

    • Comparison of electrophoretic mobility with native SHO1 (if available)

    • Verification of glycosylation pattern through glycoprotein staining

    • Circular dichroism spectroscopy to assess secondary structure elements

  • Functional validation:

    • Osmotic stress response assays in model yeast systems lacking endogenous SHO1

    • Binding assays with known interaction partners from MAP kinase pathways

    • Membrane localization studies using fluorescent tagging

    • Phosphorylation state analysis before and after osmotic shock

  • Comparative analysis:

    • Side-by-side comparison with SHO1 expressed in other systems (e.g., Pichia pastoris or E. coli)

    • Assessment of thermal stability compared to native protein

The validation strategy should be comprehensive, as correct protein folding and post-translational modifications are critical for the function of signaling proteins like SHO1.

How can recombinant U. reesii SHO1 be used to study pathogenicity mechanisms in Coccidioides?

Given the close evolutionary relationship between U. reesii and pathogenic Coccidioides species (approximately 20-30 million years of evolutionary distance) , the recombinant SHO1 can serve as a valuable tool for comparative studies:

  • Structural and functional comparison:

    • Alignment of SHO1 sequences from U. reesii and Coccidioides to identify conserved and divergent regions

    • Expression of both proteins to compare biochemical properties and signaling activities

    • Analysis of interaction partners to identify differences that might contribute to pathogenicity

  • Complementation studies:

    • Generation of SHO1 knockout strains in both U. reesii and Coccidioides

    • Cross-complementation with SHO1 from each species to identify functional differences

    • Assessment of stress tolerance and virulence phenotypes

  • Drug target identification:

    • Using recombinant U. reesii SHO1 for initial screening of compounds that could interfere with osmotic stress responses

    • Comparative screening against Coccidioides SHO1 to identify compounds with specificity for the pathogen

    • Structure-activity relationship studies to develop antifungal agents targeting SHO1

This approach leverages U. reesii as a safer alternative for initial studies before working with the pathogenic Coccidioides.

What experimental design is recommended for investigating SHO1-mediated signaling pathways in U. reesii?

A comprehensive investigation of SHO1-mediated signaling would require a multi-faceted approach:

  • Interactome mapping:

    • Yeast two-hybrid screening using SHO1 as bait to identify interaction partners

    • Co-immunoprecipitation experiments with tagged SHO1 followed by mass spectrometry

    • Bimolecular fluorescence complementation to verify interactions in vivo

  • Signaling dynamics:

    • Phosphoproteomic analysis before and after osmotic shock

    • Time-course studies to track signal propagation through downstream components

    • Comparison of wild-type and SHO1 knockout responses to osmotic stress

  • Domain function analysis:

    • Generation of SHO1 mutants with alterations in specific domains

    • Functional complementation assays to determine the role of each domain

    • Site-directed mutagenesis of predicted phosphorylation sites

Experimental ApproachAdvantagesLimitationsKey Controls
Proteomics-based interactome mappingComprehensive identification of potential partnersMay identify non-physiological interactionsInclude negative controls with unrelated proteins
PhosphoproteomicsProvides global view of signaling eventsRequires sophisticated equipmentInclude phosphatase inhibitors during extraction
Domain mutation analysisDirectly links structure to functionMay disrupt protein foldingInclude Western blots to verify expression levels
Live-cell imagingVisualizes dynamics in real timeLimited resolutionInclude membrane markers for colocalization

How do post-translational modifications affect the function of recombinant U. reesii SHO1?

Post-translational modifications (PTMs) likely play crucial roles in SHO1 function:

  • Glycosylation:

    • U. reesii expression systems provide proper glycosylation without hyperglycosylation seen in some eukaryotic systems like Pichia pastoris

    • Glycosylation patterns may affect protein stability, membrane localization, and interaction with binding partners

    • Analysis of glycosylation sites can be performed using glycosidase treatments followed by mobility shift assays

  • Phosphorylation:

    • As a signaling protein, SHO1 likely undergoes dynamic phosphorylation in response to osmotic stress

    • Phosphorylation sites can be mapped using mass spectrometry

    • Phosphomimetic mutations (S/T to D/E) and phosphoablative mutations (S/T to A) can help determine the functional significance of specific phosphorylation events

  • Other modifications:

    • Ubiquitination may regulate SHO1 turnover

    • Lipid modifications might influence membrane localization

    • Disulfide bond formation could be critical for maintaining proper conformation

Comparative studies between bacterially expressed SHO1 (lacking eukaryotic PTMs) and U. reesii-expressed SHO1 would highlight the functional importance of these modifications, similar to the enhanced activity observed for U. reesii-expressed chitinase compared to bacterially expressed versions .

How does U. reesii SHO1 compare to homologous proteins in other fungi?

A comparative analysis of SHO1 across fungal species provides evolutionary insights:

  • Sequence conservation:

    • Multiple sequence alignment of SHO1 proteins from U. reesii, Coccidioides immitis, Saccharomyces cerevisiae, and other fungi to identify conserved domains and species-specific regions

    • Phylogenetic analysis to map the evolutionary relationships

  • Structural comparison:

    • Homology modeling of U. reesii SHO1 based on known structures

    • Identification of conserved structural features across fungi

    • Analysis of species-specific structural adaptations

  • Functional conservation:

    • Complementation studies in S. cerevisiae SHO1 mutants using U. reesii SHO1

    • Comparison of osmosensing capabilities across species

    • Analysis of differential responses to various stressors

This comparative approach can reveal how SHO1 function has evolved and potentially identify adaptations related to the ecological niches of different fungi.

What are the advantages of U. reesii as an expression system compared to other systems?

U. reesii offers several advantages as an expression system for fungal proteins:

  • Proper protein folding and post-translational modifications:

    • As demonstrated with Coccidioides chitinase (Cts1), U. reesii produces recombinant proteins with proper folding and activity

    • Unlike bacterial systems, U. reesii provides eukaryotic post-translational modifications

    • Unlike some yeast systems (e.g., Pichia pastoris), U. reesii does not cause hyperglycosylation

  • Genetic manipulability:

    • Successful transformation protocols have been established

    • Heat-shock inducible promoters (HSP60) allow controlled expression

    • Selectable markers (hygromycin resistance) enable efficient selection of transformants

  • Safety and relevance:

    • Non-pathogenic alternative to working with pathogenic fungi

    • Close evolutionary relationship to Coccidioides (only 0.7% sequence divergence in 18S rRNA) makes it ideal for producing Coccidioides proteins

    • Eliminates biosafety concerns associated with pathogenic fungal expression systems

Expression SystemAdvantagesDisadvantagesBest Used For
U. reesiiProper fungal PTMs, controlled expression, non-pathogenicSlower growth than bacteria, newer systemFungal proteins requiring authentic structure
E. coliRapid growth, high yields, simple protocolsLacks eukaryotic PTMs, inclusion body formationSimple proteins without PTM requirements
Pichia pastorisEukaryotic PTMs, high yieldsHyperglycosylation, different glycan patternsSecreted proteins tolerant of glycan variations
Mammalian cellsMost authentic human-like PTMsExpensive, technically demanding, low yieldsHuman therapeutic proteins

Based on evidence with chitinase expression, U. reesii-expressed recombinant proteins show higher chitinolytic activity and greater seroreactivity than bacterially expressed counterparts, highlighting the importance of proper folding and processing .

What strategies can overcome low expression yields of recombinant SHO1 in U. reesii?

Researchers facing low expression yields can implement several optimization strategies:

  • Promoter optimization:

    • Testing alternative promoters beyond HSP60

    • Optimizing heat shock conditions (temperature and duration)

    • Exploring constitutive versus inducible expression systems

  • Codon optimization:

    • Analyzing the codon usage in the SHO1 gene and optimizing for U. reesii preferences

    • Removing rare codons that might limit translation efficiency

  • Transformation improvements:

    • Optimizing protoplast preparation to increase transformation efficiency

    • Screening larger numbers of transformants to identify high-expressing clones

    • Testing integration site effects through Southern blotting of different transformants

  • Culture condition optimization:

    • Adjusting media composition, pH, and aeration

    • Optimizing growth temperature and induction protocols

    • Testing different culture scales and formats (shake flasks versus bioreactors)

  • Protein stabilization:

    • Adding protease inhibitors to reduce degradation

    • Optimizing harvest timing to capture peak expression

    • Testing different cell lysis methods for membrane proteins like SHO1

These approaches should be systematically tested and documented to establish optimal protocols for future studies.

How can researchers address protein misfolding or aggregation issues with recombinant SHO1?

Membrane proteins like SHO1 often present folding challenges that can be addressed through:

  • Expression conditions:

    • Lowering expression temperature during induction to slow folding

    • Testing mild induction conditions to prevent overwhelming cellular machinery

    • Co-expressing chaperone proteins to assist folding

  • Solubilization strategies:

    • Screening multiple detergents for optimal extraction of properly folded protein

    • Using amphipols or nanodiscs to stabilize membrane proteins

    • Implementing on-column refolding during purification

  • Construct optimization:

    • Creating truncated constructs focusing on specific domains

    • Adding solubility-enhancing tags

    • Testing different fusion partners that enhance folding

  • Quality control:

    • Implementing size exclusion chromatography to separate monomeric from aggregated protein

    • Using dynamic light scattering to assess aggregation state

    • Verifying protein conformation through limited proteolysis

Researchers should note that proper folding is critical for function, as demonstrated by studies showing that heat inactivation of recombinant chitinase abolished both enzymatic activity and seroreactivity .

What are the critical factors for ensuring reproducibility in U. reesii SHO1 expression experiments?

Ensuring experimental reproducibility requires attention to several critical factors:

  • Strain verification and maintenance:

    • Regular verification of U. reesii strain identity

    • Consistent methods for strain preservation and revival

    • Monitoring for genetic stability of transformed strains through multiple passages

  • Standardized protocols:

    • Detailed documentation of all expression parameters

    • Consistent preparation of media and buffers

    • Calibrated equipment for temperature control during heat shock induction

  • Quality control checkpoints:

    • Regular verification of expression construct sequence

    • Consistent methods for assessing protein purity and yield

    • Standardized functional assays to verify protein activity

  • Reporting standards:

    • Comprehensive documentation of all expression conditions

    • Detailed description of strain construction and verification

    • Transparent reporting of both successful and failed optimization attempts

Critical ParameterAcceptable RangeMonitoring MethodImpact on Product
Induction temperature37°C ± 0.5°CCalibrated thermometerAffects folding and expression level
Culture pH5.5-6.5pH meterInfluences protein stability and yield
Transformation efficiency>10 transformants/μg DNAColony countingAffects screening capabilities
Protein purity>90%SDS-PAGE densitometryCritical for functional studies
Glycosylation consistencyConsistent patternGlycoprotein stainingAffects activity and stability

By addressing these factors systematically, researchers can establish robust and reproducible protocols for SHO1 expression and purification.

What emerging technologies could enhance our understanding of U. reesii SHO1 function?

Several cutting-edge technologies could significantly advance SHO1 research:

  • Cryo-electron microscopy:

    • Determination of high-resolution structure of SHO1 in membrane environments

    • Visualization of conformational changes upon osmotic stress

    • Structural basis for interactions with signaling partners

  • CRISPR-Cas9 genome editing in U. reesii:

    • Precise genomic modifications to study SHO1 function in its native context

    • Creation of reporter strains for real-time monitoring of osmotic stress responses

    • Systematic mutagenesis to map functional domains

  • Single-cell technologies:

    • Analysis of cell-to-cell variability in SHO1 expression and localization

    • Mapping of signaling dynamics at single-cell resolution

    • Correlation of SHO1 activity with cellular phenotypes

  • Structural proteomics:

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes

    • Cross-linking mass spectrometry to define protein-protein interaction interfaces

    • Ion mobility spectrometry to assess protein conformation in different conditions

These technologies could provide unprecedented insights into the molecular mechanisms of osmosensing and signal transduction in fungi.

How might comparative genomics inform our understanding of SHO1 evolution in pathogenic versus non-pathogenic fungi?

Comparative genomics approaches offer valuable insights:

  • Evolutionary analysis:

    • Reconstruction of SHO1 evolution across the fungal kingdom

    • Identification of selection pressures on different domains

    • Correlation of sequence variations with pathogenicity

  • Structural genomics:

    • Mapping sequence variations onto structural models

    • Identification of species-specific functional adaptations

    • Prediction of interaction interfaces based on co-evolving residues

  • Regulatory genomics:

    • Analysis of SHO1 promoter regions across species

    • Identification of conserved and divergent regulatory elements

    • Understanding of expression pattern differences between pathogenic and non-pathogenic species

This approach could reveal how evolutionary adaptations in SHO1 contribute to fungal lifestyle and pathogenicity, particularly in the Coccidioides-Uncinocarpus lineage that diverged approximately 20-30 million years ago .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.