Recombinant Uncinocarpus reesii Probable endonuclease LCL3 (LCL3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Uncinocarpus reesii Probable Endonuclease LCL3 (LCL3)

Recombinant Uncinocarpus reesii Probable Endonuclease LCL3 (LCL3) refers to a genetically engineered version of the LCL3 endonuclease, an enzyme originally identified in the fungus Uncinocarpus reesii . U. reesii is a non-pathogenic fungus known for its ability to degrade cellulose and other plant materials, playing a significant role in the decomposition of organic matter in soil .

Biological Significance of Uncinocarpus reesii

Uncinocarpus reesii exhibits several notable physiological characteristics :

  • It can grow on various amino acids, with a preference for substrates high in protein .

  • It can digest keratin and thrives in environments rich in animal matter .

  • It has the capacity to digest cellulose, facilitating the degradation of plant materials .

Although U. reesii itself is not known to cause diseases, it is closely related to pathogenic species in the Onygenales order, such as Coccidioides, which can cause coccidioidomycosis in humans . Comparative genomic studies involving U. reesii and Coccidioides species are valuable for understanding the evolution of pathogenicity in fungi .

Endonuclease LCL3: Function and Characteristics

Endonuclease LCL3 is a probable endonuclease, suggesting it is an enzyme that cleaves nucleic acids . While specific details on LCL3's activity, substrate preference, and mechanism in U. reesii are not available, endonucleases generally play crucial roles in DNA repair, replication, and recombination. The "recombinant" aspect indicates that the gene encoding this endonuclease has been isolated, modified, and expressed in a different host organism for research or biotechnological purposes.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your use.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
LCL3; UREG_06704; Probable endonuclease LCL3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Uncinocarpus reesii (strain UAMH 1704)
Target Names
LCL3
Target Protein Sequence
MRWLFWASPPQNDSHDASPNAHPRPIKPQRREAHQDHTPAPGQAAPEPTISNAQSSRDWN SSLNATDWKQFTEPKTIIPTALLTGGILLCVHIHRKYLRRIPEAGYISPSYFRRRSLLGK VTSVGDGDNFRLYHTPGGRLGGWEWLRKVPTGKNELRNRTIHIRLAGIDAPELPHFGRPA QPYSHEAHTWLTNYLLNRRVRAFLYRPDQYGRVVATVYVRRWLLFKQDVGLQMLKQGWAT VYEAKTGVEFGGAELERKYRDAEAWAKRRGLGLWEGLKGKKKEKWESPREFKTRMAAEEA QRK
Uniprot No.

Target Background

Database Links
Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Q&A

What is Uncinocarpus reesii Probable endonuclease LCL3?

LCL3 is a probable endonuclease protein from the non-pathogenic fungus Uncinocarpus reesii that belongs to the restriction endonuclease-like fold family. The full-length protein consists of 303 amino acids and is encoded by the LCL3 gene (also identified as UREG_06704) . Based on sequence analysis and structural predictions, LCL3 likely functions to cleave nucleic acid substrates, similar to other members of the restriction endonuclease-like superfamily . The protein has been successfully expressed as a recombinant protein with an N-terminal His-tag in E. coli expression systems .

How is Uncinocarpus reesii related to pathogenic fungi, and why is this relationship significant?

Uncinocarpus reesii is morphologically very similar to Coccidioides species but is non-pathogenic, making it an important comparative organism for studying fungal pathogenicity . Sequence analysis indicates that U. reesii is one of the closest known relatives of Coccidioides, with approximately 0.7% sequence divergence in the 18S ribosomal gene between C. immitis and U. reesii, reflecting approximately 20-30 million years of evolutionary distance .

This close evolutionary relationship is particularly significant because:

  • It allows for comparative genomic approaches to identify genetic factors associated with pathogenicity in Coccidioides

  • U. reesii serves as a safer alternative expression system for Coccidioides proteins, as Coccidioides species are classified as BSL-3 pathogens and regulated under the Select Agent Program as potential bioterrorism threats

  • The non-pathogenic nature of U. reesii reduces biosafety concerns for researchers, requiring only BSL-1 containment

What expression systems have been developed for recombinant LCL3?

Based on the search results, recombinant LCL3 has been successfully expressed in E. coli with an N-terminal His-tag . While specific details for LCL3 expression optimization are not provided, the following methodological approaches can be applied based on similar proteins:

E. coli Expression System:

  • Vector design includes an N-terminal His-tag fusion for purification

  • Expression typically occurs in standard E. coli host strains optimized for protein expression

  • Purification via nickel affinity chromatography under native or denaturing conditions

Researchers working with other fungal proteins have also developed a novel expression system using U. reesii itself as the expression host:

U. reesii Expression System:

  • Utilizes a heat shock protein gene (HSP60) promoter from Coccidioides posadasii to control transcription

  • Includes a hygromycin-B-phosphotransferase encoding gene (HPH) as a selection marker

  • Expression can be induced through temperature elevation (heat shock at 37°C)

This U. reesii expression system could potentially be adapted for expressing native or modified versions of LCL3 if post-translational modifications are important for function.

What purification protocol is recommended for recombinant LCL3?

While specific purification protocols for LCL3 are not detailed in the search results, the following methodology can be derived from similar His-tagged proteins:

  • Harvesting and Initial Processing:

    • Collect cells and lyse using appropriate buffer systems with protease inhibitors

    • Clarify lysate by centrifugation to remove cell debris

  • Affinity Chromatography:

    • Apply clarified lysate to nickel affinity resin (HisPur Ni-NTA or similar)

    • Use binding buffer containing 50 mM Tris-HCl, 0.5 M NaCl, pH 7.5 (with or without 2 M urea depending on protein solubility)

    • Wash extensively to remove non-specifically bound proteins

    • Elute with binding buffer containing 200 mM imidazole

  • Post-Purification Processing:

    • Dialyze against Tris-buffered saline to remove imidazole

    • Concentrate using Amicon Centrifugal Filter Units (10 kDa molecular weight cut-off)

    • Analyze purity by SDS-PAGE (should be >90%)

The final product can be stored in a Tris/PBS-based buffer containing 6% Trehalose or 50% glycerol at pH 8.0 for stability .

What are the optimal storage conditions for maintaining LCL3 activity?

For optimal storage and handling of recombinant LCL3, the following conditions are recommended:

Storage Conditions:

  • Store at -20°C/-80°C for long-term storage

  • Aliquot the protein to avoid repeated freeze-thaw cycles

  • For working stocks, store aliquots at 4°C for up to one week

Storage Buffer:

  • Tris/PBS-based buffer, with 6% Trehalose or 50% glycerol, pH 8.0

Reconstitution of Lyophilized Protein:

  • Briefly centrifuge prior to opening to bring contents to bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration for long-term storage aliquots

Repeated freeze-thaw cycles should be strictly avoided as they can significantly diminish enzymatic activity and lead to protein degradation .

What is the predicted function of LCL3 based on its classification in the restriction endonuclease-like fold family?

LCL3 is classified as a probable endonuclease belonging to the restriction endonuclease-like fold family, suggesting its primary function is nucleic acid cleavage . Members of this enzyme superfamily typically:

  • Recognize specific DNA sequences or structures

  • Cleave phosphodiester bonds in DNA or RNA

  • Require divalent metal ions (typically Mg²⁺) as cofactors for catalysis

The restriction endonuclease-like superfamily is extremely diverse and includes:

  • Restriction endonucleases

  • DNA repair enzymes (MutH, Vsr endonuclease)

  • Holliday junction resolvases (Hjc)

  • Exonucleases (lambda exonuclease)

  • Other nucleases involved in DNA processing

While these enzymes display limited sequence similarity, they retain a common core fold responsible for the cleavage mechanism . Based on this classification, LCL3 likely functions in DNA/RNA processing, potentially in genome maintenance, DNA repair, or defense mechanisms against foreign genetic elements.

How can researchers experimentally determine the substrate specificity of LCL3?

To characterize the substrate specificity of LCL3, researchers should employ a systematic approach:

  • Substrate Panel Testing:

    • Incubate purified LCL3 with various nucleic acid substrates (plasmid DNA, PCR products, synthetic oligonucleotides)

    • Test both single-stranded and double-stranded substrates

    • Analyze cleavage patterns using gel electrophoresis

  • Sequence Preference Analysis:

    • Use a library of DNA fragments with different sequences

    • Map cleavage sites by DNA sequencing of cleaved products

    • Compare cleavage sites to identify consensus sequences

  • Structure Preference Analysis:

    • Test substrates with different structural features (linear, circular, supercoiled)

    • Examine whether LCL3 preferentially cleaves specific DNA structures (e.g., Holliday junctions, branched structures)

  • Biochemical Parameter Optimization:

    • Determine optimal reaction conditions (pH, temperature, salt concentration)

    • Identify cofactor requirements (divalent metal ions like Mg²⁺, Mn²⁺, Ca²⁺)

    • Measure enzyme kinetics under varying conditions

  • Inhibition Studies:

    • Test sensitivity to known nuclease inhibitors

    • Evaluate competitive inhibition by substrate analogs

These experiments would provide a comprehensive profile of LCL3's substrate preferences and catalytic properties, essential information for understanding its biological function and potential applications.

What are the potential applications of LCL3 in molecular biology research?

As a member of the restriction endonuclease-like fold family, characterized LCL3 could have several research applications:

  • Molecular Cloning and DNA Manipulation:

    • If LCL3 demonstrates specific sequence recognition and cleavage, it could be used as a novel restriction enzyme for DNA manipulation

    • Potential applications in creating specific DNA fragments for cloning strategies

  • DNA Mapping Applications:

    • Could serve as a tool in restriction mapping to obtain structural information of DNA fragments or genomes

    • Mapping involves determining the order of restriction enzyme sites in genome analysis

  • Structure-Function Studies:

    • As a member of a diverse enzyme superfamily, LCL3 could provide insights into the evolutionary diversification of nuclease functions

    • Comparative analysis with other restriction endonuclease-like proteins could reveal principles of substrate recognition and catalysis

  • Fungal Biology Research:

    • Investigating LCL3's role in U. reesii may provide insights into fundamental fungal biological processes

    • Comparative studies between LCL3 and homologs in pathogenic fungi could reveal how these enzymes evolved in different ecological niches

  • Development of Novel Biotechnological Tools:

    • Engineered variants could potentially be developed for specific biotechnology applications

    • The non-pathogenic nature of U. reesii makes it an attractive source for enzymes in molecular biology applications

What catalytic mechanisms are likely employed by LCL3 based on conserved motifs in the restriction endonuclease-like fold family?

Based on analysis of the restriction endonuclease-like superfamily, LCL3 likely employs a metal ion-dependent catalytic mechanism with several conserved structural motifs:

Key Catalytic Motifs:

  • Motif I: Often contains a conserved histidine (H) or glutamic acid (E)

  • Motif II: Contains an almost invariant acidic residue (D/E)

  • Motif III: Contains conserved acidic or amide residues (D/E/Q)

These three motifs coordinate divalent metal ions (typically Mg²⁺) that are essential for catalysis. The conserved acidic residues in these motifs are critical for metal ion binding and positioning water molecules for nucleophilic attack on the phosphodiester bond .

The proposed catalytic mechanism involves:

  • Metal ion coordination by conserved acidic residues

  • Activation of a water molecule as the nucleophile

  • Nucleophilic attack on the phosphodiester backbone

  • Stabilization of the pentacovalent transition state

  • Bond cleavage and product release

Notably, the search results indicate that consensus sequences of identified restriction endonuclease-like families extend across the entire structural core and include these conserved motifs associated with cleavage .

How can structural biology approaches be applied to elucidate the function of LCL3?

To gain detailed insights into LCL3 structure and function, researchers should consider the following structural biology approaches:

These complementary approaches would provide a comprehensive understanding of LCL3's structure-function relationship, essential for elucidating its biological role and potential biotechnological applications.

How might comparative genomics between Uncinocarpus reesii and pathogenic relatives inform our understanding of LCL3?

Comparative genomic analysis between U. reesii and pathogenic fungi like Coccidioides can provide valuable insights into the evolution and function of LCL3:

  • Evolutionary Conservation and Divergence:

    • Identify LCL3 homologs in Coccidioides immitis, Coccidioides posadasii, and other related fungi

    • Compare sequence conservation in catalytic domains versus substrate recognition regions

    • Determine whether LCL3 has undergone positive selection during the evolution of pathogenicity

  • Gene Context Analysis:

    • Examine the genomic neighborhood of LCL3 in different species

    • Identify potential operonic relationships or gene clusters

    • Restriction endonuclease-like proteins frequently cooperate with their genome neighbors to perform specific biological functions

  • Domain Architecture Comparison:

    • Analyze whether LCL3 homologs in different species contain additional domains

    • Identify potential fusion events with other functional domains (e.g., DNA-binding domains, helicases)

    • Domain fusions can provide clues about functional associations

  • Expression Pattern Analysis:

    • Compare expression patterns of LCL3 homologs during different growth conditions and infection stages

    • Determine whether expression is regulated in response to specific environmental stresses

  • Functional Divergence Assessment:

    • Investigate whether LCL3 homologs in pathogenic vs. non-pathogenic fungi have different substrate preferences

    • Determine whether these differences correlate with pathogenicity

This comparative approach leverages the fact that U. reesii and Coccidioides species diverged approximately 20-30 million years ago, providing a valuable window into the genomic changes associated with the evolution of pathogenicity in this fungal lineage .

How can researchers design site-directed mutagenesis experiments to identify critical catalytic residues in LCL3?

A systematic site-directed mutagenesis approach should target predicted catalytic residues based on conserved motifs in the restriction endonuclease-like fold family:

Experimental Design Strategy:

  • Target Residue Selection:

    • Focus on conserved acidic residues (D/E) in the predicted Motifs I, II, and III

    • Include conserved histidine (H) residues that might participate in catalysis

    • Target positively charged residues (K/R) that might interact with the phosphate backbone

  • Mutation Design:

    • Conservative mutations: D→N, E→Q (maintains size but removes charge)

    • Non-conservative mutations: D/E→A (removes side chain functionality)

    • Charge reversal: D/E→K/R (tests importance of negative charge)

  • Experimental Protocol:

    • Generate mutant constructs using standard PCR-based mutagenesis methods

    • Express and purify mutant proteins following the same protocol as wild-type

    • Verify proper folding using circular dichroism or fluorescence spectroscopy

    • Assay enzymatic activity under standardized conditions

    • Compare kinetic parameters (kcat, KM) between wild-type and mutants

  • Advanced Characterization:

    • Analyze metal ion binding using isothermal titration calorimetry

    • Perform structural analysis of selected mutants

    • Measure DNA binding affinity independent of catalysis

This systematic approach will identify residues essential for catalysis versus those involved in substrate binding or structural integrity, providing insights into the catalytic mechanism of LCL3.

What approaches can be used to engineer LCL3 for potential biotechnological applications?

Engineering LCL3 for biotechnological applications would involve several strategic approaches:

  • Directed Evolution:

    • Create libraries of LCL3 variants through random mutagenesis or DNA shuffling

    • Develop high-throughput screening assays to identify variants with desired properties

    • Perform iterative rounds of selection to optimize specific characteristics

  • Rational Design:

    • Use structural information or homology models to identify target regions for modification

    • Modify substrate binding regions to alter specificity

    • Enhance catalytic efficiency through targeted mutations of active site residues

  • Domain Fusion Approaches:

    • Create chimeric proteins by fusing LCL3 with sequence-specific DNA-binding domains

    • Generate fusions with fluorescent proteins for tracking nuclease activity in vitro or in vivo

    • Develop bifunctional enzymes by combining LCL3 with complementary enzymatic activities

  • Stability Engineering:

    • Identify mutations that enhance thermostability or resistance to protease degradation

    • Optimize buffer conditions for long-term storage and activity

    • Develop immobilization strategies for reusable enzyme preparations

  • Expression Optimization:

    • Fine-tune the U. reesii expression system for high-yield production

    • Develop scalable purification protocols for industrial applications

    • Engineer secretary signals for improved extracellular production

Potential applications of engineered LCL3 variants might include novel molecular biology tools, components for diagnostic assays, or enzymes for specific biotechnological processes.

How can researchers investigate potential roles of LCL3 in genome maintenance and DNA repair?

To investigate potential roles of LCL3 in genome maintenance and DNA repair, researchers should employ a multifaceted approach:

  • Gene Disruption Studies:

    • Generate LCL3 knockout strains in U. reesii

    • Assess phenotypic changes, particularly in response to DNA-damaging agents

    • Measure mutation rates and genomic stability in knockout strains

  • Protein Localization:

    • Create fluorescently tagged LCL3 constructs

    • Monitor subcellular localization under normal conditions and following DNA damage

    • Assess co-localization with known DNA repair factors

  • Protein Interaction Studies:

    • Perform immunoprecipitation followed by mass spectrometry to identify LCL3 binding partners

    • Conduct yeast two-hybrid or bacterial two-hybrid screens

    • Validate interactions using co-immunoprecipitation and FRET approaches

  • Substrate Preference Analysis:

    • Test activity on different DNA damage substrates (e.g., abasic sites, mismatches, double-strand breaks)

    • Compare activity on normal versus damaged DNA

    • Assess preference for specific DNA structures associated with repair intermediates

  • Expression Regulation:

    • Monitor LCL3 expression in response to various DNA-damaging agents

    • Analyze promoter regions for binding sites of stress-response transcription factors

    • Measure protein levels and modification status following DNA damage

  • Comparative Analysis:

    • Examine functional similarities to characterized DNA repair enzymes in the restriction endonuclease-like fold family, such as:

      • MutH (involved in mismatch repair)

      • Vsr endonuclease (very short patch repair)

      • Holliday junction resolvases

This comprehensive approach would provide insights into whether LCL3 participates in genome maintenance pathways similar to other characterized endonucleases within its structural superfamily.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.