Recombinant Uncinocarpus reesii Protein GET1 (GET1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GET1; UREG_05616; Protein GET1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-210
Protein Length
full length protein
Species
Uncinocarpus reesii (strain UAMH 1704)
Target Names
GET1
Target Protein Sequence
MASLLIIVFLSHVVTYLINTIGATTVDNLLWLLYLKLPNNTSRTAVEQRRLKGEVVQLKR EMKSTSSQDEFAKWAKLRRRHDKAMEEYEAKNKALGKHKGSFDLTVKSVRFFSTTGLKFF LQFWYSKTPMFELPRGWVPWQVEWVLSFPRAPLGTVSIQVWSGVCTTVVSLAGDALGVVI QSLILKMTKRGVARTSEGRPSQPMALKKEL
Uniprot No.

Target Background

Function
Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. It functions as a membrane receptor for soluble GET3, which recognizes and selectively binds the transmembrane domain of TA proteins within the cytosol.
Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Uncinocarpus reesii and why is it important for recombinant protein expression?

Uncinocarpus reesii is a non-pathogenic filamentous fungus phylogenetically related to Coccidioides species, which are human pathogens that cause coccidioidomycosis (Valley fever). U. reesii serves as an important expression system for recombinant proteins because:

  • It is classified as a Biosafety Level 1 (BSL-1) organism, eliminating the significant safety concerns associated with working with BSL-3 Coccidioides species .

  • It possesses similar post-translational modification machinery to Coccidioides, allowing for proper glycosylation patterns including unique 3-O-methyl-mannose moieties that are critical for antigenicity in coccidioidal proteins .

  • It enables the generation of high-quality recombinant proteins with enhanced batch-to-batch consistency compared to native protein production .

  • As a free-living saprophyte genetically related to Coccidioides, it represents an excellent compromise between safety and functional protein expression .

What are the key benefits of using U. reesii as an expression system compared to bacterial systems?

The U. reesii expression system offers several advantages over bacterial expression systems:

  • It provides proper eukaryotic post-translational modifications, particularly glycosylation patterns that are essential for protein function and antigenicity .

  • It is the first reported expression system capable of producing proteins with 3-O-methyl mannose moieties, which are crucial for the serological activity of certain diagnostic antigens .

  • Recombinant proteins expressed in U. reesii demonstrate higher enzymatic activity compared to their bacterially expressed counterparts. For example, recombinant CTS1 (rCts1Ur) shows higher chitinolytic activity than bacterially expressed recombinant CTS1 .

  • The seroreactivity of U. reesii-expressed proteins is typically greater than that of bacterially expressed recombinant proteins, resulting in improved diagnostic performance .

  • It eliminates the need to work with pathogenic fungi while maintaining proper protein folding and function .

What types of proteins have been successfully expressed in U. reesii?

Based on the available research, several proteins have been successfully expressed in U. reesii:

  • β-glucosidase 2 (BGL2): A major component of the tube precipitin (TP) antigen that stimulates IgM antibody responses during early Coccidioides infection. The recombinant BGL2 (rBGL2ur) retained its antigenicity and contained the critical 3-O-methyl-mannose moiety .

  • Chitinase 1 (CTS1): An important complement fixation (CF) antigen used in coccidioidomycosis diagnostics. The recombinant CTS1 (rCts1Ur) demonstrated chitinolytic activity identical to the native protein and showed comparable serodiagnostic efficacy to commercially available antigens .

  • Both these proteins retained their functional activity and serological reactivity, demonstrating the versatility of the U. reesii expression system for diagnostic antigen production .

How does the genetic transformation process work for U. reesii and what factors influence transformation efficiency?

The genetic transformation of U. reesii involves several sophisticated steps:

  • Preparation of arthroconidia: U. reesii is grown on GYE agar (1% glucose, 0.5% yeast extract, 1.5% agar) at 30°C for 3 weeks to produce arthroconidia for transformation .

  • Protoplast generation: Germ tubes from U. reesii arthroconidia are digested with a cocktail of enzymes including lysing enzymes, Driselase, and recombinant coccidioidal chitinase 1 to remove the cell wall and produce protoplasts .

  • DNA delivery: The expression plasmid is linearized (e.g., by XbaI digestion) and then incubated with U. reesii protoplasts in the presence of polyethylene glycol (Mn 3350) and calcium ions to facilitate DNA uptake .

  • Selection process: Transformants are initially selected on GYE agar supplemented with 75 μg/ml hygromycin B followed by subsequent passages on media containing 100 μg/ml hygromycin B to obtain stable transformed clones. This progressive increase in antibiotic concentration helps select first for heterokaryotic transformants and then for homokaryotic cells .

  • Confirmation of transformation: PCR screening is used to confirm the presence of the integrated transgene in the U. reesii genome .

Key factors affecting transformation efficiency include protoplast quality, DNA purity, linearization efficiency of the vector, and the selection strategy used to isolate stable transformants.

What is the significance of the 3-O-methyl-mannose modification in U. reesii-expressed proteins?

The 3-O-methyl-mannose modification in U. reesii-expressed proteins has profound implications for both protein function and serological applications:

  • Unique epitope formation: The 3-O-methyl-mannose moiety forms the predominant IgM epitope on proteins like BGL2, which is critical for stimulating early antibody responses during Coccidioides infection .

  • Diagnostic specificity: This unique glycosylation pattern contributes to the specificity of diagnostic tests by creating epitopes that are recognized by antibodies produced during true coccidioidal infections .

  • Limited availability: This specific modification is not produced by commonly used protein expression systems including bacteria, yeast, or mammalian cells, making U. reesii uniquely valuable for producing certain diagnostic antigens .

  • Evolutionary significance: The presence of this rare glycosylation pattern in both Coccidioides and U. reesii reflects their close phylogenetic relationship and may provide insights into the evolution of pathogenicity in this fungal group .

  • Confirmed presence: Gas chromatography analysis has been used to demonstrate the presence of 3-O-methyl mannose on recombinant proteins expressed in U. reesii .

How does the HSP60 promoter system function in U. reesii and what factors influence gene expression levels?

The heat shock protein 60 (HSP60) promoter system in U. reesii offers a controlled and inducible method for recombinant protein expression:

  • Origin and design: The promoter is derived from the Coccidioides posadasii HSP60 gene and is incorporated into expression vectors such as pCE-TP or pCE-CTS1 to control transcription of the inserted target gene .

  • Induction mechanism: The HSP60 promoter is heat-inducible, allowing for controlled expression of the recombinant protein by elevating the cultivation temperature. This temperature-based induction provides a simple method for initiating protein production at the desired time point .

  • Functionality across species: The C. posadasii HSP60 promoter functions effectively in U. reesii, indicating conservation of transcription regulation mechanisms between these related fungal species .

  • Integration mechanism: Evidence suggests that the expression plasmid integrates into the U. reesii genome, as the transformants maintain stable hygromycin resistance phenotypes. This integration is necessary since the plasmids do not contain artificial chromosome elements such as autonomously replicating sequences or telomeres .

  • Expression kinetics: The induction of recombinant protein expression via the HSP60 promoter allows for the accumulation of the target protein in the culture medium, facilitating downstream purification processes .

What purification strategies are most effective for recombinant proteins expressed in U. reesii?

Effective purification of recombinant proteins from U. reesii involves several strategic approaches:

  • Affinity chromatography: Incorporation of affinity tags such as the His(6x)-tag at the C-terminus of the recombinant protein allows for efficient purification using nickel affinity chromatography. This was successfully demonstrated with rBGL2ur, which was purified directly from the culture medium .

  • Secreted expression: The expression vectors are designed to include signal peptides that direct the recombinant proteins to be secreted into the culture medium, simplifying the purification process by eliminating the need for cell lysis .

  • Quality control: Purified proteins can be analyzed by techniques such as SDS-PAGE for purity assessment, gas chromatography for glycosylation analysis, and enzyme assays (where applicable) to confirm functional activity .

  • Scalability: The purification process from U. reesii culture medium appears to be scalable, allowing for the production of sufficient quantities of purified protein for diagnostic or research applications while maintaining consistent quality .

  • Protein yield: While specific yields vary depending on the protein and expression conditions, the system has been shown to produce sufficient quantities of functional proteins for analytical and diagnostic applications .

How can researchers optimize growth conditions to maximize recombinant protein yield in U. reesii?

Optimization of growth conditions is critical for maximizing recombinant protein yield in U. reesii:

  • Temperature regulation: Since the HSP60 promoter is heat-inducible, careful temperature management is essential. Typically, initial growth at standard temperature (around 30°C) followed by elevation to induce expression has proven effective .

  • Media composition: GYE media (1% glucose, 0.5% yeast extract) has been successfully used for U. reesii cultivation. Optimization of carbon and nitrogen sources may further enhance growth and protein production .

  • Growth phase considerations: Timing the induction of protein expression to coincide with the optimal growth phase of the culture can significantly impact protein yields. Monitoring growth curves can help determine the ideal induction point .

  • Statistical modeling: Advanced statistical techniques can be applied to analyze production trajectories and determine optimal harvest times. Spline-based modeling of mean trajectories has proven useful for analyzing variability in protein production curves .

  • Replication strategy: When designing experiments to optimize conditions, balanced experimental designs with adequate replication are important. Even with limited data points, parametric bootstrap methods can help characterize variability and confidence intervals for production parameters .

  • Production kinetics: Two key parameters to optimize are "time to harvest" and "maximal productivity," which can be analyzed using specialized statistical techniques even when data availability is limited .

What analytical methods are recommended for evaluating the quality and functionality of U. reesii-expressed recombinant proteins?

Comprehensive analytical methods for quality and functionality assessment include:

  • Glycosylation analysis: Gas chromatography has been successfully used to confirm the presence of specific glycan structures such as 3-O-methyl mannose on recombinant proteins .

  • Enzymatic activity assays: For enzymes like chitinase (CTS1), specific activity assays comparing the recombinant protein with native counterparts provide functional validation. For rCts1Ur, chitinolytic activity identical to the native protein was demonstrated .

  • Serological reactivity: ELISA (enzyme-linked immunosorbent assay) using patient sera is critical for evaluating diagnostic antigens. In one study, rBGL2ur showed 78.8% sensitivity and 87.3% specificity when tested with sera from 90 patients with coccidioidomycosis and 134 control individuals .

  • Comparative testing: Side-by-side comparison with commercial diagnostic tests (e.g., ID-TP assay, MiraVista Diagnostic IgM) provides benchmarking of performance. rBGL2ur performed better than the ID-TP assay (33.3% sensitivity; 100% specificity) and comparably to the proprietary MVD IgM test (63.3% sensitivity; 96.3% specificity) .

  • Batch consistency: Evaluation of batch-to-batch variation is essential for diagnostic applications. The recombinant expression system in U. reesii offers improved consistency compared to native antigen production .

  • Statistical analysis: Advanced statistical techniques such as bootstrap-based inference procedures can be applied to evaluate variability across different experimental conditions, even when limited data are available .

What are the current limitations of the U. reesii expression system and how might they be addressed?

The U. reesii expression system, while promising, faces several challenges:

How might cryptic species within U. reesii impact recombinant protein expression?

The presence of cryptic species within U. reesii presents both challenges and opportunities:

  • Genetic diversity: Research has identified at least two cryptic species within what is classified as U. reesii, with genetic divergence observed across multiple genes. This genetic diversity could impact transformation efficiency and protein expression capabilities .

  • Strain selection: The identification of nucleotide polymorphisms (at a rate of approximately 2.1% across 1,273 nucleotides in three genes) indicates the importance of careful strain selection for recombinant protein expression .

  • Evolutionary relationships: Understanding the phylogenetic relationships between U. reesii cryptic species and Coccidioides species may help in selecting optimal strains for expressing specific Coccidioides proteins .

  • Taxonomic considerations: Researchers should be aware that the strain designation "U. reesii UAMH 3881" may actually represent a complex of closely related but genetically distinct organisms, potentially requiring re-evaluation of strain identity in expression systems .

  • Performance variability: Different cryptic species within U. reesii might vary in their protein expression efficiency or post-translational modification capabilities, suggesting the need for comparative studies across multiple authenticated strains .

What novel applications beyond diagnostic antigens might be developed using the U. reesii expression system?

The versatility of the U. reesii expression system opens possibilities for applications beyond diagnostic antigens:

  • Vaccine development: Expression of immunogenic Coccidioides proteins in a non-pathogenic system could facilitate the development of subunit vaccines without BSL-3 containment requirements .

  • Enzyme production: The demonstrated ability to produce active enzymes such as chitinase and β-glucosidase suggests potential applications in industrial enzyme production, particularly for enzymes requiring specific fungal post-translational modifications .

  • Structural biology: The system could enable production of properly folded and modified fungal proteins for structural studies, potentially providing insights into pathogenicity mechanisms .

  • Glycobiology research: As a unique system capable of producing proteins with 3-O-methyl-mannose modifications, U. reesii could serve as a valuable tool for studying the role of this rare glycosylation in protein-protein interactions and immune recognition .

  • Evolutionary studies: Comparative analysis of protein modifications between U. reesii and pathogenic relatives could help elucidate the evolutionary development of pathogenicity factors in the Onygenales .

What statistical approaches are recommended for analyzing variability in recombinant protein production?

Several statistical approaches are particularly valuable for analyzing variability in recombinant protein production:

  • Spline representation: Modeling mean trajectories of protein production using spline representation provides a flexible framework for capturing complex production curves even with limited time points .

  • Bootstrap-based inference: For experiments with limited replication, bootstrap-based methods offer robust approaches for parameter estimation and hypothesis testing. Three main variants are applicable:

    Bootstrap MethodBest Application ScenarioAdvantages
    Nonparametric bootstrapWhen assumptions about error distribution are uncertainMakes minimal distributional assumptions
    Residual bootstrapWhen model structure is reliable but error distribution is unknownMore efficient use of available data
    Parametric bootstrapWhen data are very limited but prior information on variability existsCan function with extremely small sample sizes
  • Multiple comparison procedures: When comparing multiple experimental conditions, adjusted procedures that account for multiple testing are essential to control false discovery rates .

  • Balanced experimental design: Even with limited resources, ensuring a balanced design (equal sample size at each observational time for every treatment) improves statistical power and simplifies analysis .

  • Modeling with t-distributions: For biological data with potential extreme values, using scaled t-distributions with low degrees of freedom can more effectively reflect the variability in real data compared to Gaussian assumptions .

How can researchers determine optimal harvest times for maximizing recombinant protein yield?

Determining optimal harvest times involves sophisticated analysis of production trajectories:

What are the key considerations for researchers planning to use U. reesii as an expression system?

Researchers considering U. reesii as an expression system should:

  • Evaluate biosafety advantages: The BSL-1 classification of U. reesii provides significant safety and regulatory benefits compared to working with pathogenic fungi, especially for proteins normally produced by BSL-3 organisms .

  • Consider glycosylation requirements: If specific fungal post-translational modifications (particularly 3-O-methyl-mannose) are critical for protein function or antigenicity, U. reesii offers unique advantages over bacterial or yeast systems .

  • Plan for appropriate vector design: Incorporating the HSP60 promoter, appropriate signal sequences, and affinity tags facilitates controlled expression and simplified purification .

  • Implement proper strain authentication: Given the existence of cryptic species, researchers should ensure proper identification and characterization of their U. reesii strain .

  • Develop appropriate analytical methods: Comprehensive characterization of recombinant proteins should include glycosylation analysis, functional assays, and appropriate serological testing for diagnostic applications .

  • Establish statistical frameworks: Even with limited experimental capacity, appropriate statistical design and analysis can maximize the information gained from recombinant protein production experiments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.