Recombinant Uncinocarpus reesii Putative dipeptidase UREG_03382 (UREG_03382)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order remarks if necessary. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request but incurs additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
UREG_03382; Putative dipeptidase UREG_03382
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-453
Protein Length
full length protein
Species
Uncinocarpus reesii (strain UAMH 1704)
Target Names
UREG_03382
Target Protein Sequence
MSTRDHVKQSPMPVQEGYPRSSKEFSPPSSRSRKRTWVRNLTMSLLIAAGAATFSKYIFP LGSILGAGSLQPIDPHDYAARADRILSTTPLIDGHNDLPYLIRLETKNKIYDHEKLPFEA GLLSHTDAKKIRQGKLGGQFWSVYVECPADPSAGIDDPSWAVRDTLEQIDVAKRLVDEYP DLLEYCETASCARSAFKKGRVGSFLGIEVHDLGVRYITVTHNCDNAFATAASTVAAGKPD HGLTDFGREFVKEMNRLGMLIDLSHVSHQTMRDVLSVTNAPVIFSHSSSYALSKHLRNVP DDVLRTVTKNGGVVMVTFVPLFLKVNDPASVTIHDAVDHILHVAKVAGWDHVGIGSDFDG TAVVPKGLENVSKYPRLVELLLERGVTDEQARKLVGENLLRVWSKAEDIAYAIQASGQKP NEETWSGRKWTAAADIPMPSMFNDSAERRKQLE
Uniprot No.

Target Background

Function
Hydrolyzes a wide range of dipeptides.
Database Links
Protein Families
Metallo-dependent hydrolases superfamily, Peptidase M19 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Recombinant Uncinocarpus reesii Putative Dipeptidase UREG_03382?

Recombinant Uncinocarpus reesii Putative Dipeptidase UREG_03382 (UniProt ID: C4JQN7) is a full-length protein (453 amino acids) derived from the non-pathogenic fungus Uncinocarpus reesii. The protein is typically expressed with an N-terminal histidine tag in E. coli expression systems, which facilitates its purification and detection in experimental settings. Uncinocarpus reesii is phylogenetically related to the pathogenic fungus Coccidioides, making its proteins valuable for comparative studies and potential diagnostic applications in fungal research.

What are the optimal storage conditions for UREG_03382?

For long-term storage, UREG_03382 should be stored at -20°C to -80°C immediately upon receipt. The protein is typically supplied as a lyophilized powder and requires aliquoting after reconstitution to prevent damage from repeated freeze-thaw cycles. For working stocks, aliquots can be stored at 4°C for up to one week, but longer storage at this temperature is not recommended. For optimal protein stability, a storage buffer consisting of Tris/PBS-based buffer with 6% Trehalose at pH 8.0 is recommended to maintain protein integrity and biological activity.

What is the recommended reconstitution protocol for lyophilized UREG_03382?

The following methodological approach is recommended for optimal reconstitution:

  • Briefly centrifuge the vial before opening to ensure all material is at the bottom

  • Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation)

  • Aliquot the reconstituted protein into smaller volumes for long-term storage at -20°C/-80°C

This protocol minimizes protein degradation and maintains sample integrity for downstream applications. The addition of glycerol serves as a cryoprotectant to prevent damage during freezing.

What are the advantages of expressing UREG_03382 in E. coli versus fungal expression systems?

The expression of UREG_03382 in bacterial versus fungal systems presents distinct advantages depending on research objectives:

Expression SystemAdvantagesLimitationsBest Applications
E. coli- Higher protein yields
- Rapid growth
- Well-established protocols
- Cost-effective
- Lacks eukaryotic post-translational modifications
- Potential inclusion body formation
- May require refolding
- Structural studies
- Antibody production
- Initial characterization
Uncinocarpus reesii- Native-like post-translational modifications
- Proper protein folding
- Secreted protein (easier purification)
- Lower yields
- Longer cultivation time
- More complex transformation procedures
- Functional studies
- Enzymatic assays
- Diagnostic applications

For applications requiring authentic enzymatic activity, expression in U. reesii may be preferable despite lower yields, as demonstrated in comparable systems where fungal expression preserved important glycosylation patterns.

How can I perform transformation of Uncinocarpus reesii for expression of recombinant proteins?

Transformation of U. reesii employs protocols similar to those used for Coccidioides species with the following methodological steps:

  • Grow U. reesii UAMH 3881 (ATCC 34534) on GYE agar (1% glucose, 0.5% yeast extract, 1.5% agar) at 30°C for 3 weeks to produce arthroconidia

  • Generate germ tubes from arthroconidia and digest with a combination of lysing enzymes, Driselase, and recombinant chitinase to produce protoplasts

  • Linearize the expression plasmid containing your gene of interest with appropriate restriction enzymes (e.g., XbaI)

  • Incubate protoplasts with the linearized plasmid in the presence of polyethylene glycol and calcium ions

  • Select transformants on GYE agar supplemented with 75 μg/ml hygromycin B initially

  • Perform 3 subsequent passages on GYE agar with increased hygromycin concentration (100 μg/ml) to obtain stable transformants

  • Confirm successful transformation by PCR screening of genomic DNA from fungal transformants

This procedure yields stable U. reesii transformants capable of expressing your protein of interest under appropriate promoters, such as the heat-shock protein promoter (HSP60).

What expression vector features are optimal for UREG_03382 expression in Uncinocarpus reesii?

When designing expression vectors for UREG_03382 in U. reesii, incorporate the following key elements:

  • A strong promoter such as the Coccidioides HSP60 promoter (CpHSP60), which can be recognized by U. reesii transcription machinery

  • A C-terminal or N-terminal histidine tag sequence for purification purposes

  • Selection markers suitable for fungi, such as hygromycin resistance genes

  • Appropriate terminator sequences, such as the CpHSP60 terminator

  • Sequences that facilitate genomic integration, as exemplified in the pCE-TP plasmid design

These vector elements ensure efficient transcription, translation, and subsequent purification of the recombinant protein in the U. reesii system.

What is the optimal purification protocol for His-tagged UREG_03382 from U. reesii culture?

The following step-by-step purification protocol can be implemented for His-tagged UREG_03382:

  • Grow the transformed U. reesii strain in GYE medium with 75 μg/ml hygromycin at 30°C for 5 days

  • Induce protein expression by heat shock at 37°C for 1-2 days

  • Harvest the culture filtrate by passing the culture through Whatman Grade 1 filter paper using vacuum filtration

  • Precipitate proteins from the filtrate by adding ammonium sulfate to 90% saturation on ice

  • Collect the protein precipitate by centrifugation

  • Solubilize the pellet in binding buffer (50 mM Tris-HCl, 0.5 M NaCl, 2 M urea, pH 7.5)

  • Perform nickel affinity chromatography using HisPur Ni-NTA Resin under denaturing conditions with 2 M urea

  • Elute the protein with binding buffer containing 200 mM imidazole

  • Dialyze the eluted protein against Tris-buffered saline

  • Concentrate the protein using Amicon Centrifugal Filter Units with 10 kDa molecular weight cut-off

This protocol can be adapted depending on whether the protein is intracellular or secreted into the culture medium. For UREG_03382, purification from the culture medium is advantageous if the protein is naturally secreted.

How can I assess the purity and integrity of purified UREG_03382?

Multiple complementary analytical methods should be employed to comprehensively evaluate protein purity and integrity:

  • SDS-PAGE Analysis: Perform gel electrophoresis to assess protein purity, with expected purity >90% for research applications. Visualize using Coomassie blue staining.

  • Western Blot Verification:

    • Separate protein samples by SDS-PAGE

    • Transfer proteins onto PVDF membranes

    • Probe with anti-His-tag monoclonal antibody

    • Develop using appropriate detection systems to confirm identity and integrity

  • Mass Spectrometry Analysis:

    • Tryptic digest followed by LC-MS/MS analysis

    • Peptide mass fingerprinting to confirm sequence coverage

    • Identification of potential post-translational modifications

  • Functional Assays: Design enzyme activity assays based on predicted dipeptidase function to confirm that the purified protein retains catalytic activity.

How can I determine the enzymatic activity of UREG_03382 dipeptidase?

As a putative dipeptidase, UREG_03382 likely catalyzes the hydrolysis of dipeptides. A comprehensive enzymatic characterization should include:

  • Substrate Specificity Profiling:

    • Test activity against a panel of chromogenic or fluorogenic dipeptide substrates

    • Measure product formation using spectrophotometric or fluorometric assays

    • Analyze data to determine substrate preference patterns

  • Kinetic Parameter Determination:

    • Perform reactions at various substrate concentrations

    • Plot initial reaction velocities against substrate concentrations

    • Calculate Km, Vmax, kcat, and kcat/Km values using appropriate enzyme kinetics models

  • pH and Temperature Optima:

    • Conduct activity assays across a range of pH values (e.g., pH 4-9)

    • Test enzymatic activity at different temperatures (25-60°C)

    • Generate pH and temperature activity profiles

  • Inhibitor Studies:

    • Screen the effect of known protease/peptidase inhibitors

    • Determine IC50 values for effective inhibitors

    • Elucidate inhibition mechanisms (competitive, non-competitive, etc.)

What experimental approaches can be used to investigate UREG_03382's role in Uncinocarpus reesii biology?

To elucidate the biological function of UREG_03382, consider these research strategies:

  • Gene Knockout/Knockdown Studies:

    • Generate UREG_03382 deletion mutants in U. reesii

    • Analyze phenotypic changes in growth, morphology, and stress responses

    • Perform complementation studies to confirm phenotype specificity

  • Protein Localization Analysis:

    • Create GFP-fusion constructs with UREG_03382

    • Express in U. reesii and visualize using fluorescence microscopy

    • Determine subcellular localization and potential temporal regulation

  • Interaction Partner Identification:

    • Perform co-immunoprecipitation experiments using anti-His antibodies

    • Identify interaction partners by mass spectrometry

    • Validate key interactions using techniques like yeast two-hybrid or FRET

  • Comparative Genomics:

    • Analyze homologs in related fungi including Coccidioides species

    • Compare expression patterns under various growth conditions

    • Investigate evolutionary conservation and potential functional divergence

What are the considerations for using UREG_03382 in structural biology studies?

Structural characterization of UREG_03382 requires careful experimental design:

  • Protein Sample Preparation:

    • Ensure high purity (>95%) through additional purification steps if needed

    • Verify monodispersity using dynamic light scattering

    • Optimize buffer conditions for structural stability

  • Crystallization Screening:

    • Perform high-throughput crystallization trials with commercial screens

    • Optimize promising conditions for crystal growth

    • Consider co-crystallization with substrates or inhibitors

  • NMR Spectroscopy Approach:

    • Express isotopically labeled protein (15N, 13C) in minimal media

    • Collect multidimensional NMR spectra

    • Analyze chemical shift data for structural information

  • Cryo-EM Considerations:

    • Assess protein size suitability (UREG_03382 at ~50 kDa may require strategies to increase molecular weight)

    • Optimize grid preparation protocols

    • Collect and process high-resolution image data

How does UREG_03382 compare with homologous proteins in pathogenic fungi?

Understanding the relationship between UREG_03382 and its homologs in pathogenic fungi provides valuable insights into functional evolution:

SpeciesProtein HomologSequence Identity (%)Key DifferencesFunctional Implications
Uncinocarpus reesiiUREG_03382100 (reference)N/APutative dipeptidase activity in non-pathogenic fungus
Coccidioides speciesBGL2 (β-glucosidase 2)Partial homologyContains unique glycosylation patterns (3-O-methyl-mannose)Major antigen in Valley fever diagnosis; altered substrate specificity
Other related fungiVarious dipeptidasesVariableDifferent substrate recognition domainsPotential adaptation to ecological niches

This comparative analysis highlights the evolutionary relationships between U. reesii proteins and those in pathogenic relatives, potentially informing therapeutic target development.

Can UREG_03382 serve as a model for studying homologous proteins in pathogenic fungi?

The non-pathogenic nature of U. reesii makes UREG_03382 an excellent model system for studying homologous proteins from biosafety level 3 (BSL-3) pathogens like Coccidioides. Consider these methodological approaches:

  • Heterologous Expression System Development:

    • Optimize UREG_03382 expression in U. reesii as a proof-of-concept

    • Apply similar methodologies to express homologous proteins from pathogenic fungi

    • Compare protein properties in a standardized expression system

  • Structure-Function Relationship Studies:

    • Generate chimeric proteins between UREG_03382 and pathogenic homologs

    • Identify critical domains through domain swapping experiments

    • Correlate structural features with enzymatic properties

  • Biosafety Advantages:

    • Conduct preliminary characterization using the non-pathogenic homolog

    • Reduce the need for BSL-3 containment in early research stages

    • Develop and validate experimental protocols using the safer surrogate

The use of U. reesii as an expression system for proteins from pathogenic fungi has been demonstrated successfully with proteins like BGL2 from Coccidioides, emphasizing its utility in comparative studies.

How can I develop diagnostic applications using UREG_03382 expressed in U. reesii?

The successful expression of recombinant proteins in U. reesii has demonstrated potential for diagnostic applications, particularly for fungal diseases. Consider this methodological framework:

  • Antigen Development Strategy:

    • Express the target protein (like UREG_03382) in U. reesii to maintain native-like post-translational modifications

    • Purify using affinity chromatography to obtain high-purity antigen

    • Validate antigen integrity through multiple analytical approaches

  • Assay Development Process:

    • Optimize protein coating conditions for ELISA plates

    • Determine appropriate blocking reagents to minimize background

    • Establish optimal sample dilution ranges and incubation parameters

    • Validate with known positive and negative control sera

  • Performance Assessment:

    • Calculate sensitivity and specificity using well-characterized clinical samples

    • Compare against existing diagnostic methods

    • Perform receiver operating characteristic (ROC) analysis to determine optimal cutoff values

For example, a similar approach using Coccidioides proteins expressed in U. reesii achieved 78.8% sensitivity and 87.3% specificity, comparable to commercial assays and superior to some conventional tests.

What considerations are important when analyzing post-translational modifications of UREG_03382?

Post-translational modifications (PTMs) can significantly impact protein function and immunogenicity. Consider these analytical approaches:

  • Glycosylation Analysis:

    • Perform enzymatic deglycosylation (PNGase F, Endo H) followed by mobility shift analysis

    • Use lectin arrays to identify specific glycan structures

    • Employ gas chromatography to identify unique sugars, such as 3-O-methyl mannose

    • Consider mass spectrometry for comprehensive glycan profiling

  • Phosphorylation Assessment:

    • Use phospho-specific staining or antibodies

    • Perform titanium dioxide enrichment followed by MS/MS analysis

    • Map phosphorylation sites to functional domains

  • Other PTM Characterization:

    • Investigate proteolytic processing through N-terminal sequencing

    • Identify disulfide bonds through non-reducing vs. reducing gel comparison

    • Assess other modifications such as acetylation or methylation by mass spectrometry

  • Comparison Between Expression Systems:

    • Evaluate differences in PTMs between E. coli-expressed and U. reesii-expressed UREG_03382

    • Correlate PTM differences with functional implications

    • Determine which expression system produces the most native-like modifications

How can I improve poor expression yields of UREG_03382 in recombinant systems?

Optimizing expression yields requires systematic troubleshooting:

  • E. coli Expression Optimization:

    • Test different E. coli strains (BL21(DE3), Rosetta, Arctic Express)

    • Optimize induction parameters (IPTG concentration, temperature, duration)

    • Consider co-expression with chaperones to improve folding

    • Test different fusion tags (MBP, SUMO) to enhance solubility

  • Uncinocarpus reesii Expression Enhancement:

    • Optimize promoter selection and codon usage

    • Evaluate different signal sequences for secreted expression

    • Adjust culture conditions (medium composition, pH, aeration)

    • Implement fed-batch cultivation strategies to increase biomass

    • Optimize heat shock parameters for HSP60 promoter-driven expression

  • Experimental Design Considerations:

    • Monitor expression over time to determine optimal harvest point

    • Analyze protein stability in culture conditions

    • Consider protein toxicity and adjust expression strategies accordingly

What strategies can address protein aggregation or misfolding during UREG_03382 purification?

Protein aggregation and misfolding represent significant challenges in recombinant protein work:

  • Prevention Strategies During Expression:

    • Lower incubation temperature (16-25°C) to slow folding and reduce aggregation

    • Co-express with molecular chaperones

    • Use solubility-enhancing fusion partners

  • Solubilization Approaches:

    • Optimize buffer conditions (pH, salt concentration, additives)

    • Include mild detergents (0.05-0.1% Tween-20 or Triton X-100)

    • Add stabilizing agents (glycerol, trehalose, arginine)

    • Consider mild denaturants followed by refolding strategies

  • Purification Modifications:

    • Implement on-column refolding during affinity chromatography

    • Use size exclusion chromatography to separate aggregates

    • Consider ion exchange chromatography under conditions that stabilize native conformation

  • Quality Control Methods:

    • Monitor aggregation state using dynamic light scattering

    • Assess secondary structure using circular dichroism

    • Verify function using activity assays after each purification step

What emerging technologies could enhance UREG_03382 research?

Several cutting-edge methodologies show promise for advancing UREG_03382 research:

  • CRISPR/Cas9 Genome Editing in U. reesii:

    • Develop efficient transformation and gene editing protocols

    • Create precise knockouts, knockins, and point mutations

    • Enable systematic functional genomics studies

  • Cryo-electron Tomography:

    • Visualize UREG_03382 in its native cellular environment

    • Map subcellular localization at nanometer resolution

    • Understand protein organization in fungal cells

  • AlphaFold and Machine Learning Applications:

    • Generate accurate structural predictions to guide experimental work

    • Identify potential binding partners through computational interface prediction

    • Design improved variants with enhanced stability or activity

  • Single-Cell Proteomics:

    • Investigate cell-to-cell variability in UREG_03382 expression

    • Correlate protein levels with cellular phenotypes

    • Understand protein dynamics during different growth phases

How might comparative genomics advance our understanding of UREG_03382 function?

Genomic approaches provide powerful insights into protein function and evolution:

  • Phylogenetic Analysis Approach:

    • Construct comprehensive phylogenetic trees of UREG_03382 homologs

    • Identify conserved regions suggesting functional importance

    • Detect signatures of selection that might indicate specialized functions

  • Synteny Analysis Methodology:

    • Compare genomic context of UREG_03382 across fungal species

    • Identify co-evolved gene clusters suggesting functional relationships

    • Detect operon-like structures that might indicate metabolic pathways

  • Transcriptomic Correlation Studies:

    • Analyze co-expression patterns under various conditions

    • Identify genes with similar expression profiles suggesting functional relationships

    • Compare expression regulation between pathogenic and non-pathogenic species

  • Natural Variation Assessment:

    • Catalog sequence variations in UREG_03382 across fungal isolates

    • Correlate sequence differences with phenotypic variations

    • Identify potential substrate specificity determinants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.