Recombinant Uncinocarpus reesii Signal peptidase complex catalytic subunit SEC11 (SEC11)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Uncinocarpus reesii Signal Peptidase Complex Catalytic Subunit SEC11 (SEC11)

The Recombinant Uncinocarpus reesii Signal peptidase complex catalytic subunit SEC11 (SEC11) is a recombinant protein derived from the fungus Uncinocarpus reesii. This protein is part of the signal peptidase complex, which plays a crucial role in the processing of proteins by removing N-terminal signal sequences. These sequences are essential for targeting proteins to the endoplasmic reticulum (ER) for further processing and secretion.

Function of Signal Peptidase Complex

The signal peptidase complex is responsible for cleaving the signal peptides from nascent proteins as they are translocated into the ER. This process is vital for the proper maturation and secretion of proteins. The SEC11 subunit, specifically, is a catalytic component of this complex, facilitating the precise removal of signal sequences to ensure correct protein targeting and function.

Characteristics of Recombinant SEC11

  • Source: The recombinant SEC11 protein can be produced in various expression systems, including E. coli, Baculovirus, and mammalian cells.

  • Purity: The protein is typically purified to a high degree, often exceeding 85% purity as determined by SDS-PAGE.

  • Synonyms: SEC11; UREG_07275; Signal peptidase complex catalytic subunit SEC11; Signal peptidase I.

Data Table: Characteristics of Recombinant SEC11

CharacteristicDescription
SourceE. coli, Baculovirus, Mammalian cells
Purity>85% (SDS-PAGE)
SynonymsSEC11; UREG_07275; Signal peptidase complex catalytic subunit SEC11; Signal peptidase I
FunctionCatalytic component of the signal peptidase complex, involved in cleaving N-terminal signal sequences from nascent proteins

Potential Applications

The recombinant SEC11 protein could be used in various biotechnological applications, including protein expression systems where efficient signal peptide processing is crucial. Additionally, understanding its role in protein maturation could provide insights into disease mechanisms related to protein misprocessing.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to meet specific needs.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
SEC11; UREG_07275; Signal peptidase complex catalytic subunit SEC11; Signal peptidase I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-210
Protein Length
full length protein
Species
Uncinocarpus reesii (strain UAMH 1704)
Target Names
SEC11
Target Protein Sequence
MLSSLSPHLSNVRQTLTQVLNFALVLSTAFMMWKALSIYTNSSSPIVVVLSGSMEPAFQR GDLLFLWNRSPRAEVGEIVVYNVRGKDIPIVHRVVRAFGDDARDPKEGGGKKGKSASGTG KKESVAAGAVHSDSSFVSHKLLTKGDNNIADDTELYARGQDYLDRKVDLVGSVRGYIPAV GYVTIMLSEHPWLKSVLLGLMGVMVILQRE
Uniprot No.

Target Background

Function

Recombinant Uncinocarpus reesii Signal Peptidase Complex Catalytic Subunit SEC11 (SEC11)

SEC11 is a catalytic component of the signal peptidase complex (SPC). It catalyzes the cleavage of N-terminal signal sequences from proteins destined for the endoplasmic reticulum (ER). This signal peptide cleavage occurs during or after translocation through the translocon pore into the ER.

Database Links
Protein Families
Peptidase S26B family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Uncinocarpus reesii and why is it used for recombinant protein expression?

Uncinocarpus reesii is a non-pathogenic fungus that is phylogenetically related to pathogenic Coccidioides species, with approximately 20-30 million years of evolutionary distance. The sequence divergence of the 18S ribosomal gene between C. immitis and U. reesii is approximately 0.7% .

U. reesii has become an important expression system for recombinant proteins because:

  • It can be handled under Biosafety Level 1 (BSL1) containment, unlike Coccidioides species which require BSL3 facilities

  • It can produce proteins with appropriate post-translational modifications, including unique glycosylation patterns like 3-O-methyl-mannose moieties that are critical for antigenicity

  • It provides a safer alternative for producing diagnostic antigens that would otherwise require cultivation of pathogenic Coccidioides species

What is the signal peptidase complex and what role does SEC11 play in it?

The signal peptidase complex (SPC) is an essential membrane component in the endoplasmic reticulum that removes signal peptides from secretory pre-proteins with high specificity . SEC11 functions as a catalytic subunit of this complex.

Key aspects of SEC11 include:

  • SEC11 exists as paralogs (SEC11A and SEC11C in humans)

  • In yeast, SEC11 is essential for signal peptide processing and cell growth, with null mutations being lethal

  • SEC11 proteins are related to the family of eubacterial and eukaryotic signal peptidases

  • The catalytic mechanism involves a Ser-His-Asp triad, with conserved residues critical for function

How is recombinant SEC11 expressed in U. reesii?

Based on established protocols for expressing recombinant proteins in U. reesii, the following methodology can be applied to SEC11 expression:

  • Vector Construction:

    • Design an expression vector containing the SEC11 gene under the control of a heat-shock inducible promoter (such as CpHSP60)

    • Include appropriate selection markers (e.g., hygromycin resistance)

  • Transformation Procedure:

    • Grow U. reesii UAMH 3881 (ATCC 34534) on GYE agar at 30°C for 3 weeks to produce arthroconidia

    • Generate protoplasts by digesting germ tubes with lysing enzymes, Driselase, and chitinase

    • Transform protoplasts with the linearized expression construct in the presence of polyethylene glycol and calcium ions

    • Select transformants on media containing hygromycin B (initially at 75 μg/ml, then increase to 100 μg/ml for stable transformants)

  • Protein Induction and Purification:

    • Induce protein expression by elevating cultivation temperature (heat shock)

    • Purify the recombinant protein from culture medium using affinity chromatography

    • Confirm protein identity through amino acid sequence analysis

What are the advantages of using U. reesii versus other expression systems for SEC11?

Expression SystemAdvantagesDisadvantages
U. reesii- Produces proteins with fungal-specific post-translational modifications
- BSL1 containment requirements
- Can produce proteins with 3-O-methyl mannose glycosylation
- Closely related to Coccidioides species
- Less established than other systems
- Slower growth compared to bacterial systems
- More complex transformation protocol
E. coli- Rapid growth
- High protein yields
- Well-established protocols
- Lacks eukaryotic post-translational modifications
- May form inclusion bodies
- Cannot produce glycosylated proteins
Yeast- Eukaryotic processing
- Moderate growth rate
- Well-characterized genetics
- Different glycosylation patterns than filamentous fungi
- Cannot produce 3-O-methyl mannose modifications
Coccidioides- Native protein production
- Authentic post-translational modifications
- BSL3 containment required
- Safety concerns
- Slow growth
- Potential for laboratory-acquired infections

What are the key structural features of SEC11 proteins?

SEC11 proteins have several important structural elements:

  • Catalytic Domain:

    • Contains a Ser-His-Asp catalytic triad essential for enzymatic activity

    • The catalytic residues Ser56/68 (in box B) and His96/108 (in box D) are positioned similarly to the Ser-Lys dyad in bacterial SPase I

    • Three conserved aspartic acid residues (Asp116/128, Asp121/133, and Asp122/134) near the binding pocket, with Asp122/134 best positioned to complete the catalytic triad

  • Transmembrane Regions:

    • N-terminal transmembrane helix anchors the protein in the membrane

    • C-terminal region contains a "pseudo-SP helix" that resembles an inverted signal peptide

  • Conserved Sequence Motifs:

    • Contains conserved sequence stretches commonly referred to as boxes A-E, which are important for catalytic function

How can site-directed mutagenesis be used to study SEC11 function?

Site-directed mutagenesis provides valuable insights into SEC11 structure-function relationships:

  • Catalytic Residue Analysis:

    • Mutating Asp122/134 has moderate effects on protein stability while completely abolishing catalytic activity

    • Mutating Asp116/128 has more severe effects on protein stability but retains some catalytic activity

    • Mutating Asp121/133 has little effect on both stability and activity

  • Experimental Design for Mutagenesis Studies:

    • Generate recombinant SEC11 variants with targeted mutations in conserved residues

    • Express mutant proteins in U. reesii

    • Purify proteins and assess:

      • Protein stability through thermal denaturation assays

      • Catalytic activity using appropriate substrates (e.g., pre-β-lactamase processing assay)

      • Structural integrity through circular dichroism or other biophysical methods

  • Functional Domains Mapping:

    • Mutate residues in the signal peptide binding groove to identify key substrate interaction sites

    • Generate truncated variants to determine the minimal functional domain

    • Create chimeric proteins by swapping domains between SEC11A and SEC11C to identify paralog-specific functions

How can recombinant U. reesii SEC11 be used for comparative studies with pathogenic fungi?

Recombinant SEC11 from U. reesii enables comparative studies with pathogenic fungi through several approaches:

  • Evolutionary Analysis:

    • Compare SEC11 sequences and structures from U. reesii, Coccidioides species, and other fungi

    • Identify conserved and divergent regions that may relate to pathogenicity

    • Analyze selection pressures on different domains of the protein

  • Functional Complementation:

    • Express U. reesii SEC11 in SEC11-deficient strains of other fungi to assess functional conservation

    • Determine if U. reesii SEC11 can restore signal peptide processing in SEC11 mutants

  • Substrate Specificity Analysis:

    • Compare the substrate specificity of SEC11 from U. reesii with that from pathogenic fungi

    • Identify differences in processing efficiency for various signal peptides

    • Use this information to understand the evolution of host-pathogen interactions

What challenges might arise when expressing SEC11 in U. reesii and how can they be addressed?

ChallengePotential Solutions
Low expression levels- Optimize codon usage for U. reesii
- Test different promoters (constitutive vs. inducible)
- Optimize culture conditions (temperature, media composition)
- Screen multiple transformants to identify high producers
Protein misfolding- Co-express chaperones
- Optimize growth temperature
- Add stabilizing agents to culture media
- Create fusion proteins with solubility-enhancing tags
Proteolytic degradation- Add protease inhibitors during purification
- Generate protease-deficient U. reesii strains
- Optimize purification protocols to minimize processing time
Inconsistent glycosylation- Analyze glycosylation patterns batch-to-batch
- Standardize culture conditions
- Consider enzymatic deglycosylation if consistency is problematic
Genetic instability- Ensure proper integration of the expression construct
- Maintain selection pressure
- Regularly verify the genetic integrity of producing strains

How is SEC11 involved in pathogenic processes and what are the implications for research?

Recent studies have identified important roles for SEC11 in disease processes:

  • SEC11A in Cancer:

    • SEC11A is significantly upregulated in head and neck squamous cell carcinoma (HNSC)

    • High SEC11A expression is independently associated with poorer progression-free survival (HR: 2.075, 95%CI: 1.447–2.977, p<0.001) and disease-specific survival (HR: 2.023, 95%CI: 1.284–3.187, p=0.002)

    • SEC11A expression shows a moderate positive correlation with gene-level copy number (Pearson's r = 0.53, p<0.001)

    • SEC11A expression correlates negatively with CD8+ T cells and B cells, but positively with cancer-associated fibroblasts and myeloid-derived suppressor cells in the tumor microenvironment

  • Research Implications:

    • Studying SEC11 function across species may reveal conserved mechanisms relevant to human disease

    • Understanding SEC11 substrate specificity could help identify key proteins involved in pathogenesis

    • SEC11 inhibitors could be developed as potential therapeutic agents for cancers with SEC11A overexpression

What methodological approaches can be used to study SEC11 interactions with substrates?

Several advanced techniques can be employed to study SEC11-substrate interactions:

  • Crosslinking Mass Spectrometry:

    • Use chemical crosslinking followed by mass spectrometry to identify proteins that interact with SEC11

    • Apply photoactivatable crosslinkers incorporated into SEC11 or its substrates

    • Analyze interaction sites through fragmentation patterns

  • Substrate Trapping:

    • Generate catalytically inactive SEC11 mutants that can bind but not process substrates

    • Isolate these complexes and identify bound substrates through proteomics

    • Map the binding interface using structural biology techniques

  • Fluorescence-Based Assays:

    • Develop FRET-based assays with fluorescently labeled SEC11 and substrates

    • Monitor real-time processing of labeled substrates

    • Screen for conditions or compounds that affect processing efficiency

  • Structural Biology Approaches:

    • Use cryo-electron microscopy to visualize SEC11 in complex with substrates

    • Apply X-ray crystallography to obtain high-resolution structures of SEC11-substrate complexes

    • Perform molecular dynamics simulations to understand the dynamics of substrate recognition

What emerging technologies could enhance our understanding of recombinant U. reesii SEC11?

Several cutting-edge technologies could significantly advance SEC11 research:

  • CRISPR-Cas9 Genome Editing in U. reesii:

    • Generate precise knockouts or modifications of native SEC11

    • Create reporter strains to monitor SEC11 expression and localization

    • Engineer synthetic regulatory circuits to control SEC11 expression

  • Single-Cell Analysis of SEC11 Function:

    • Apply single-cell transcriptomics to understand cell-to-cell variability in SEC11 expression

    • Use single-molecule imaging to track SEC11 dynamics in living cells

    • Develop microfluidic approaches to study SEC11 function in individual cells

  • Artificial Intelligence for Substrate Prediction:

    • Develop machine learning algorithms to predict SEC11 substrates based on signal peptide sequences

    • Use deep learning to model SEC11-substrate interactions

    • Apply computational approaches to design optimized substrates or inhibitors

How might comparative genomics inform our understanding of SEC11 evolution and function across fungal species?

Comparative genomics offers powerful insights into SEC11 biology:

  • Evolutionary Analysis:

    • Compare SEC11 sequences across diverse fungi to identify conserved and variable regions

    • Reconstruct the evolutionary history of SEC11 gene duplication events

    • Identify selection pressures acting on different domains of SEC11

  • Synteny Analysis:

    • Examine the genomic context of SEC11 across fungal species

    • Identify co-evolved genes that may function with SEC11

    • Discover regulatory elements controlling SEC11 expression

  • Structure-Function Mapping:

    • Correlate sequence variations with functional differences in SEC11 across species

    • Identify species-specific substrate preferences

    • Develop predictive models for SEC11 substrate specificity based on evolutionary patterns

  • Methodology:

    • Generate multiple sequence alignments of SEC11 homologs

    • Calculate conservation scores for each amino acid position

    • Perform phylogenetic analyses to understand the relationship between sequence, structure, and function

    • Map conservation data onto structural models to identify functionally important regions

What are the critical parameters for optimizing SEC11 expression in U. reesii?

ParameterRecommendationsRationale
Promoter selectionCpHSP60 heat shock protein promoterProvides controlled induction through temperature shift, proven effective for protein expression in U. reesii
Codon optimizationAdapt to U. reesii codon usageEnhances translation efficiency and protein yield
Growth temperature30°C for growth, elevated temperature for inductionOptimal growth of U. reesii occurs at 30°C, while protein induction can be triggered by temperature elevation
Media compositionGYE (1% glucose, 0.5% yeast extract)Supports robust growth of U. reesii
Induction timing3 weeks of growth before inductionEnsures sufficient biomass for protein production
Selection markerHygromycin B (75-100 μg/ml)Effective for selecting stable transformants
Signal sequenceNative or optimized fungal signal sequenceEnsures proper targeting and secretion of the recombinant protein
Affinity tag positionC-terminal tag preferredMinimizes interference with signal peptide processing

What analytical methods are most appropriate for characterizing recombinant SEC11 produced in U. reesii?

A comprehensive analytical toolkit for SEC11 characterization includes:

  • Protein Identity and Purity:

    • SDS-PAGE with silver staining for purity assessment

    • Western blotting with anti-SEC11 or anti-tag antibodies

    • Mass spectrometry for accurate mass determination and sequence confirmation

    • N-terminal sequencing to verify correct signal peptide processing

  • Post-Translational Modifications:

    • Glycan analysis by mass spectrometry

    • Gas chromatography to detect and quantify 3-O-methyl mannose

    • Lectin binding assays to profile glycosylation patterns

    • Deglycosylation studies to determine the contribution of glycans to function

  • Structural Characterization:

    • Circular dichroism for secondary structure analysis

    • Thermal shift assays to assess protein stability

    • Limited proteolysis to identify domain boundaries and flexible regions

    • Small-angle X-ray scattering for low-resolution structural information

  • Functional Analysis:

    • Enzymatic activity assays using model substrates (e.g., pre-β-lactamase)

    • Substrate specificity profiling using peptide libraries

    • Inhibition studies to identify active site residues

    • Binding assays to measure substrate affinity

What are common problems encountered when expressing SEC11 in U. reesii and how can they be resolved?

ProblemPossible CausesSolutions
No detectable protein expression- Promoter not functioning
- Improper induction conditions
- Protein instability
- Incorrect construct design
- Verify construct sequence
- Test alternative promoters
- Optimize induction conditions
- Check mRNA expression by RT-PCR
- Add protease inhibitors during extraction
Protein expressed but not active- Improper folding
- Missing post-translational modifications
- Inhibitory contaminants in preparation
- Mutations in catalytic residues
- Optimize purification conditions
- Verify protein sequence
- Test different buffer conditions
- Add cofactors if required
- Express protein with chaperones
Inconsistent glycosylation patterns- Variation in culture conditions
- Heterogeneous cell population
- Media composition differences
- Stress during cultivation
- Standardize growth conditions
- Use single-colony isolates
- Carefully control media preparation
- Monitor culture health metrics
Genetic instability of transformants- Integration in unstable genomic regions
- Toxic effects of expressed protein
- Selection pressure too low
- Recombination events
- Screen multiple transformants
- Maintain selection pressure
- Regularly check construct integrity
- Use different integration sites
Low transformation efficiency- Poor quality protoplasts
- Inefficient DNA delivery
- Suboptimal regeneration conditions
- DNA toxicity
- Optimize protoplast preparation
- Adjust PEG concentration and DNA amount
- Improve regeneration media
- Use freshly prepared reagents

How can researchers validate the proper folding and function of recombinant SEC11?

Multiple complementary approaches can validate recombinant SEC11 quality:

  • Enzymatic Activity Assays:

    • Compare activity of recombinant SEC11 with native protein using standardized substrates

    • Measure kinetic parameters (Km, Vmax) and compare to published values

    • Test activity under various conditions (pH, temperature, ionic strength)

  • Structural Validation:

    • Use circular dichroism to confirm proper secondary structure content

    • Apply fluorescence spectroscopy to assess tertiary structure

    • Perform thermal denaturation studies to determine stability profiles

    • Compare structural features with known SEC11 structures from related organisms

  • Functional Complementation:

    • Express recombinant SEC11 in SEC11-deficient yeast strains

    • Determine if recombinant protein can rescue the temperature-sensitive phenotype of sec11 mutants

    • Compare growth rates and secretion profiles of complemented strains

  • Substrate Recognition:

    • Test processing of known SEC11 substrates

    • Compare substrate specificity profiles with native SEC11

    • Analyze cleavage site preferences using peptide libraries

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.