Recombinant Uncoordinated protein 58 (unc-58)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant Uncoordinated Protein 58 (UNC-58) is a full-length, Caenorhabditis elegans-derived potassium channel subunit produced in E. coli with an N-terminal His tag for purification . This 591-amino acid protein (UniProt ID: Q22271) belongs to the two-pore domain potassium channel (K2P) family and plays critical roles in regulating neuronal and muscle excitability .

Table 2: Functional Outcomes of UNC-58 Mutations

Mutation TypePhenotypeMechanism
GOF (e665)Hypercontraction, paralysisNa+ influx due to altered selectivity
LOF (qa3788/bln223)Reduced thrashing rateTruncated C-terminus and TM4 defect

Key Findings from Recent Studies

  1. CRISPR-Induced LOF: The qa3788 mutation reduced thrashing rates by 30% compared to wild-type C. elegans, mimicking null mutants .

  2. C-Terminus Importance: Deletion of the C-terminus disrupts channel gating, highlighting its role in maintaining ion flux .

  3. Functional Redundancy: LOF phenotypes are mild due to compensatory mechanisms by other K2P channels (e.g., TWK-7) .

Considerations for Experimental Use

  • Validation: Sequence co-CRISPR loci post-editing to avoid undetected LOF mutations .

  • Phenotypic Masking: UNC-58 LOF mutants may subtly affect locomotion-dependent assays .

  • Storage: Reconstitute lyophilized recombinant UNC-58 in sterile water (0.1–1.0 mg/mL) with 50% glycerol for long-term stability .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preferences when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
unc-58; T06H11.1; Uncoordinated protein 58
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-591
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
unc-58
Target Protein Sequence
MFFYSPNVAPQPSSTSHRRPTLTHQHHLHVGHLDTRLSVQIPEILSRSLVHDPERTRLVP EQLRFIIDENQELWTGSQPPTGFLELCASPVSSVFSNADARRMSQRKLVLRRPTISIQED GKIIIDHVTARWEGANINSQSALLDADDGATVITDTIKDDQDDKEPKSCPQQTVKYIKIL TPHVILVSVLIGYLCLGAWILMLLETRTELLARSKKLVRLTNLMSNFTAESWKMLNNAQH GVSNMDEGEWAATFREWMVRVSETVDDRRPIRRELNRPDDLSNMHNKWTFPTAILYVLTV LTTCGYGEVSVDTDVGKVFSVAFALVGIPLMFITAADIGKFLSETLLQFVSFWNRSVRKV KQWMSRIRHGRRKSLQSTGGPNDTLDILGVDGTEEKLWFPIGAYVSCICIYCSIGSAMFI TWERTWSFIHAFHFGFNLIVTVGLGDIVVTDYIFLSLIVAFVIVGLSVVTMCVDLASTHL KAYFTRIHYFGRAKRFLGMSEELKEIVALLGAMRRKKGGKVTWNDVRDFLDNELRDRPFE PHELLMKLRFIDETSSGMSTIRHNSFQSDFFRESEYIRRVAALRPEQPAYL
Uniprot No.

Target Background

Function
Plays a role in mobility, potentially involved in potassium transport in muscles.
Database Links

KEGG: cel:CELE_T06H11.1

STRING: 6239.T06H11.1a

UniGene: Cel.4940

Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of unc-58 and how does it function in C. elegans?

The unc-58 gene encodes a potassium channel subunit with multiple transmembrane domains that regulates neuronal excitability in C. elegans. The wild-type protein contains at least four transmembrane domains, with the fourth domain beginning around amino acid position 431 . The protein functions as a two-pore-domain potassium (K2P) channel that helps maintain appropriate membrane potential in neurons. It is widely expressed in interneurons and motor neurons, playing a crucial role in the control of locomotion . The channel's proper function is essential for coordinated movement, as mutations can lead to dramatic changes in motility and muscle tone.

How do different unc-58 mutations affect protein function and organismal phenotype?

Mutations in unc-58 produce distinct phenotypes based on whether they cause gain-of-function (GOF) or loss-of-function (LOF):

Mutation TypeMolecular ConsequenceObservable PhenotypeDetection MethodResearch Utility
Gain-of-Function (GOF)Altered ion selectivity, allowing sodium ions to passHypercontraction, severe uncoordinated movement, paralysisVisual inspectionEasily identifiable marker for CRISPR/Cas9 editing
Loss-of-Function (LOF)Truncated protein, missing ~70% of C-terminal domainSubtle locomotion defects, impaired motility in liquidThrashing assays, sequencingMore challenging to identify visually, requires molecular confirmation

The GOF phenotype likely results from loss of ion selectivity that allows sodium ions to pass through the channel, facilitating depolarization of motor neurons and explaining the uncoordinated phenotype and hypercontracted state observed in affected worms . LOF mutations present more subtle phenotypes because there are compensatory mechanisms for the absence of functional unc-58 .

Why is unc-58 commonly used as a co-CRISPR marker gene in C. elegans research?

The unc-58 gene serves as an effective co-CRISPR marker because:

  • GOF mutations produce an easily observable uncoordinated phenotype characterized by hypercontraction and paralysis

  • This visible phenotype facilitates selection of worms that have likely undergone CRISPR editing

  • The distinctive phenotype serves as a "live marker" for successful CRISPR events in the target gene of interest

  • It can be used to identify "jackpot broods" (broods with high CRISPR efficiency) when numerous progeny display the unc-58 phenotype

These characteristics make unc-58 valuable in experimental workflows where researchers need visual indicators of successful gene editing without molecular screening of all animals.

What are the limitations and potential confounds when using unc-58 as a co-CRISPR marker?

Several important limitations must be considered when using unc-58 as a co-CRISPR marker:

  • Unlike other co-CRISPR genes (e.g., dpy-10, sqt-1), unc-58 does not produce easily recognizable phenotypes for both GOF and LOF mutations

  • LOF mutations in unc-58 may occur without producing an obvious phenotype that can be detected by visual inspection alone

  • Cryptic mutations in unc-58 might be carried forward in experiments if researchers rely solely on phenotypic screening without molecular verification

  • These "phenotypically silent" mutations can nonetheless impact locomotion when measured quantitatively (e.g., thrashing behavior assays)

  • Segregating the co-CRISPR modified gene can be challenging if the CRISPR target and co-CRISPR genes are difficult to separate genetically

Due to these limitations, researchers using unc-58 as a co-CRISPR marker should implement robust verification protocols rather than relying on phenotypic appearance alone.

What protocols should researchers follow when using unc-58 as a selection marker in CRISPR experiments?

When using unc-58 as a co-CRISPR marker, researchers should follow these methodological steps:

  • Injection preparation: Prepare a CRISPR injection mix containing:

    • Cas9-encoding plasmid

    • sgRNA for the target gene

    • Repair template for the target gene

    • sgRNA for unc-58

    • Repair template designed to generate GOF mutation in unc-58

  • Injection and screening:

    • Inject the CRISPR mix into young adult C. elegans gonads

    • Identify F1 broods containing uncoordinated progeny (indicating successful unc-58 editing)

    • Look specifically for "jackpot broods" containing high numbers of unc-58 marked progeny (>30)

    • Select both marked (uncoordinated) and unmarked (apparently wild-type) siblings for molecular screening

  • Verification:

    • Sequence the target region of interest in selected worms

    • Crucially, also sequence the unc-58 locus to confirm its genotype regardless of phenotype

    • Identify worms with the desired edit in the target gene

  • Strain purification:

    • Perform genetic crosses to segregate the desired mutation from any unc-58 mutations

    • Verify both loci by sequencing after crossing

    • Establish pure strains containing only the desired edit

How can researchers detect and characterize unexpected unc-58 mutations?

To detect unexpected unc-58 mutations that may be phenotypically silent:

  • DNA sequence analysis:

    • PCR amplify the unc-58 region surrounding the CRISPR target site

    • Perform Sanger sequencing to identify any modifications

    • Compare with wild-type sequence to detect insertions, deletions, or substitutions

  • Protein sequence prediction:

    • Translate the mutated DNA sequence to predict protein changes

    • Identify potential frameshift mutations that may lead to premature stop codons

    • Analyze the impact on functional domains (e.g., transmembrane regions)

  • Phenotypic assessment:

    • Conduct thrashing assays in liquid to quantitatively assess subtle locomotion defects

    • Compare with known null mutants to determine functional impact

    • Use additional behavioral assays to detect subtle neurological phenotypes

A documented example found a mutant with a 2-nucleotide deletion followed by a 15-nucleotide insertion at the Cas9 cut site, creating a frameshift mutation with a premature stop codon at position 467, deleting approximately 70% of the C-terminal domain and disrupting the fourth transmembrane domain .

How can researchers leverage unc-58 genetics to study ion channel function and neuronal excitability?

unc-58 provides a valuable model for investigating fundamental questions about ion channel function:

  • Electrophysiological studies:

    • Compare membrane properties between wild-type, GOF, and LOF unc-58 mutants

    • Test the hypothesis that GOF mutations alter ion selectivity allowing sodium conductance

    • Investigate how different domains contribute to channel function through structure-function analyses

  • Neuronal circuit analysis:

    • Examine how altered unc-58 function affects specific neuronal populations

    • Map the effects of unc-58 mutations on downstream circuit components

    • Investigate compensatory mechanisms that mitigate the effects of LOF mutations

  • Comparative studies:

    • Relate findings from unc-58 research to understanding potassium channels in other organisms

    • Use insights from C. elegans to inform studies of homologous channels in mammals

What alternative co-CRISPR markers should researchers consider when studying neuromuscular phenotypes?

When studying neuromuscular function or behavior, researchers should consider these alternative co-CRISPR markers to avoid confounds:

Co-CRISPR GeneAdvantagesPhenotypesBest Applications
dpy-10Produces recognizable phenotypes for both GOF and LOF mutationsDumpy, roller, or dumpy-rollerStudies involving locomotion or neuronal function
sqt-1Clear phenotypes for both mutation typesRoller phenotypeBehavioral studies where subtle movement defects matter
rol-6Well-characterizedRoller phenotype, subtle LOFGeneral purpose marker

When using co-CRISPR approaches for studies that depend on neuronal excitability or complex behaviors, it is advisable to:

  • Choose markers less likely to have confounding effects on the biological process being studied

  • Combine markers that produce visible phenotypes from GOF mutations with approaches that promote homology-directed repair (HDR)

  • Always sequence the co-CRISPR gene regardless of phenotype

  • Generate proper control strains that account for potential co-CRISPR gene effects

How should researchers address contradictory or unexpected results when working with unc-58 mutants?

When facing unexpected results with unc-58 mutants:

  • Verify genotypes thoroughly:

    • Sequence both the target gene and unc-58 locus completely

    • Look for unexpected rearrangements, not just the expected mutations

    • Consider whole-genome sequencing to detect off-target effects

  • Quantitative phenotyping:

    • Use multiple assays to assess locomotion (e.g., thrashing, crawling speed, reversal frequency)

    • Compare results across different environmental conditions

    • Analyze phenotypes at different developmental stages

  • Generate genetic controls:

    • Create strains with only the unc-58 mutation for comparison

    • Use established unc-58 mutant strains (e.g., CB665 unc-58(e665)) as references

    • Perform rescue experiments to confirm phenotype causality

  • Consider cellular contexts:

    • Examine cell-specific effects using cell-type specific markers

    • Investigate whether phenotypes depend on particular neural circuits

    • Compare effects in different genetic backgrounds

What emerging technologies might improve co-CRISPR approaches that currently rely on unc-58?

Future directions for improving co-CRISPR approaches include:

  • Alternative selection strategies:

    • Developing fluorescent markers that don't affect neuronal function

    • Creating selection systems based on drug resistance rather than visible phenotypes

    • Implementing inducible markers that can be activated only during screening

  • Enhanced methodologies:

    • Improving HDR efficiency to reduce reliance on phenotypic markers

    • Developing multiplexed CRISPR approaches with higher specificity

    • Creating computational tools to predict and minimize off-target effects

  • Comprehensive validation:

    • Implementing standardized sequencing protocols for all CRISPR experiments

    • Developing high-throughput phenotyping platforms to detect subtle behavioral effects

    • Creating databases of known off-target effects and solutions

By addressing these considerations and implementing rigorous methodological approaches, researchers can maximize the utility of unc-58 as a research tool while minimizing potential confounds in their experiments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.