Recombinant Undecaprenyl-diphosphatase 2 (uppP2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
uppP2; bacA2; upk2; SAV_7021; Undecaprenyl-diphosphatase 2; Bacitracin resistance protein 2; Undecaprenyl pyrophosphate phosphatase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Target Names
uppP2
Target Protein Sequence
MSWFESLILGLVQGLTEFLPVSSSAHLRLTAAFAGWEDPGAAFTAITQIGTEAAVLIYFR KDIARIISAWFRSLVNKEMRHDHDAQMGWLVIVGSIPIGVLGVTLKDQIEGPFRDLRITA TMLIVMGVILGIADRLAARDETGGKHRAAKERKKLQDLNIRDGLVFGACQAMALIPGVSR SGATISGGLLIGYTRESAARYSFLLAIPAVLASGVFELKDAAASGHVAWGPTVFATVIAF VSGYAVIAWFMKFISNKSFMPFVWYRIALGIAIIALVATGALSPHAAESAG
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Undecaprenyl-diphosphatase 2 (uppP2)?

Undecaprenyl-diphosphatase 2 (uppP2) is an integral membrane protein that plays a critical role in bacterial cell wall synthesis. It catalyzes the dephosphorylation of undecaprenyl pyrophosphate (UPP/C55PP) to undecaprenyl phosphate (C55P/Und-P), which serves as an essential carrier lipid for peptidoglycan components. This conversion is a crucial step in the lipid II cycle, where the carrier molecule shuttles cell wall precursors across the cytoplasmic membrane. The enzyme's activity directly impacts bacterial cell envelope integrity, as the undecaprenyl phosphate carrier is required for both peptidoglycan and wall teichoic acid synthesis in many bacteria .

Where is uppP2 localized in bacterial cells and how does this relate to its function?

Studies on the structural topology of uppP2 have revealed that the enzyme is oriented with its active site facing the periplasm. The enzyme contains two conserved regions with (E/Q)XXXE and PGXSRSXXT motifs, plus a histidine residue that are localized near the aqueous interface of the protein and oriented toward the periplasmic side. This orientation implies that the enzyme's biological function occurs on the outer side of the plasma membrane, where it participates in recycling of the undecaprenyl carrier after it has delivered its cargo for cell wall synthesis. Crystal structure analysis at 2.6 Å resolution confirms this orientation, showing the protein has a pocket extending into the membrane that opens to the periplasm and the periplasmic leaflet .

What is the importance of uppP2 in bacterial cell viability?

The dephosphorylation of undecaprenyl pyrophosphate by phosphatases like uppP2 is essential for bacterial viability. Research using optimized CRISPR interference (CRISPRi) systems has demonstrated that in Bacillus subtilis, depletion of UPP phosphatase activity (through simultaneous targeting of both UppP and BcrC) is lethal, as these enzymes perform redundant but essential functions. The loss of UPP phosphatase activity leads to morphological defects consistent with cell envelope synthesis failure and strongly activates stress response mechanisms. This essentiality makes uppP2 and related phosphatases potential targets for antibiotic development. Without functional UPP phosphatases, bacteria cannot recycle the lipid carrier, which disrupts peptidoglycan synthesis and ultimately compromises cell envelope integrity .

What are the key structural features of uppP2 and how do they relate to catalytic function?

The three-dimensional structure of uppP2 reveals several distinctive features critical to its function:

  • Unique Topology: The enzyme incorporates an interdigitated inverted topology repeat, a structure previously only reported in transporters and channels. It consists of an N-repeat (residues 1-150) and a C-repeat (residues 151-273), each beginning with a re-entrant helix pair followed by three transmembrane helices .

  • Active Site Pocket: The protein features a cavity extending halfway across the membrane that opens to the periplasm and the periplasmic leaflet. The active site resides at the bottom of this pocket, where conserved residues crucial for catalysis are positioned .

  • Conserved Motifs: Two consensus regions containing (E/Q)XXXE plus PGXSRSXXT motifs and a histidine residue form the catalytic site. Mutagenesis studies have confirmed that residues within these motifs (including E17, E21, H30, S173, R174, and T178) are essential for enzyme activity .

  • Metal Ion Binding: The enzyme exhibits an absolute requirement for magnesium or calcium ions for catalytic activity. The model suggests that residues like Glu-17 and Glu-21 interact with the pyrophosphate moiety of the substrate through a magnesium ion .

What experimental evidence supports the proposed active site of uppP2?

Multiple approaches have provided evidence for the location and composition of the uppP2 active site:

  • Site-Directed Mutagenesis: Mutations of specific residues in the conserved regions dramatically affect enzyme activity. For example:

    • E17A mutation decreases kcat values approximately 5-fold and increases the Km value for the substrate by 4-5-fold

    • The double mutation E17A/E21A completely eliminates enzyme activity

    • H30A mutation severely impairs enzyme activity

    • S173A, R174A, and T178A mutations within the PGXSRSXXT motif also render the enzyme inactive

  • Molecular Dynamics Simulations: MD simulations validated the structural model and revealed how the active site residues interact with the substrate. The conserved Arg-174 establishes a hydrogen bond with the hydroxyl group of the pyrophosphate moiety, while His-30 is positioned in close proximity to the pyrophosphate group .

  • Structural Analysis: The crystal structure determination at 2.6 Å resolution confirmed the location of the active site pocket and the orientation of key catalytic residues .

How do different bacterial species vary in their UPP phosphatases, and what are the implications for antibacterial targeting?

Bacteria often possess redundant UPP phosphatases that may function on different sides of the membrane, providing flexibility in UPP recycling. For example:

  • Redundancy Pattern: In Bacillus subtilis, two UPP phosphatases (UppP and BcrC) perform overlapping functions. Either enzyme alone is sufficient for viability, but the deletion of both is lethal .

  • Stress Response Connection: The gene encoding BcrC is part of the σM-dependent cell envelope stress response, suggesting a regulatory mechanism to increase UPP phosphatase activity under stress conditions .

  • Alternative Enzymes: Some bacteria possess additional phosphatases that can support growth when overexpressed. In B. subtilis, YodM (a predicted lipid phosphatase with homology to diacylglycerol pyrophosphatases) can support growth when overexpressed in strains depleted of both UppP and BcrC .

This diversity and redundancy in UPP phosphatases across bacterial species presents both challenges and opportunities for antibacterial development. An effective therapeutic approach might need to target multiple phosphatases simultaneously or identify unique features shared across different bacterial UPP phosphatases .

What are the optimal expression systems for producing active recombinant uppP2?

The choice of expression system for recombinant uppP2 depends on research objectives and required protein characteristics:

  • E. coli and Yeast Systems: These offer the best yields and shorter turnaround times for basic structural and functional studies. E. coli systems are particularly advantageous for isotopic labeling for NMR studies or when post-translational modifications are not critical .

  • Insect Cell/Baculovirus Expression: This system provides many of the post-translational modifications necessary for correct protein folding. It represents a middle ground between bacterial expression and mammalian systems in terms of yield, complexity, and eukaryotic processing capabilities .

  • Mammalian Cell Expression: When native-like post-translational modifications are crucial for retaining the protein's activity, mammalian expression systems are preferable. Though yields are typically lower, the protein quality may be superior for certain applications .

For membrane proteins like uppP2, specialized E. coli strains with modified membrane properties or incorporation of fusion partners that aid in membrane insertion may improve expression yields and functionality .

What purification strategies are most effective for obtaining structurally intact and functionally active uppP2?

Purification of membrane proteins like uppP2 requires specialized approaches:

  • Detergent Selection: The choice of detergent is critical for extracting uppP2 from membranes while maintaining its structure and function. Previous successful work has utilized bacteriorhodopsin as a fusion tag at the N-terminus to facilitate extraction and purification .

  • Affinity Chromatography: Histidine-tagged variants enable efficient purification via Ni-NTA chromatography, followed by size exclusion chromatography to remove aggregates.

  • Lipid Addition: Including specific phospholipids during purification or reconstitution can stabilize the protein and enhance activity. Since uppP2 requires interaction with lipid substrates, maintaining a lipid-like environment during purification is important.

  • Quality Assessment: Functional assays measuring phosphatase activity against synthetic substrates like farnesyl pyrophosphate (Fpp) can confirm that the purified protein retains enzymatic activity. Additionally, circular dichroism spectroscopy can verify proper folding of the transmembrane helices .

How can researchers effectively reconstitute purified uppP2 for functional studies?

For functional characterization of uppP2, appropriate reconstitution methods are essential:

  • Liposome Reconstitution: Incorporating purified uppP2 into liposomes composed of E. coli lipids or defined lipid mixtures can create a native-like membrane environment. The protein-to-lipid ratio should be optimized to prevent overcrowding or insufficient protein density.

  • Nanodiscs: Reconstitution into nanodiscs provides a defined, stable membrane environment suitable for structural and kinetic studies. This approach is particularly valuable for biophysical characterization and single-molecule studies.

  • Activity Buffer Optimization: Enzymatic assays should include appropriate divalent cations (Mg²⁺ or Ca²⁺) at optimal concentrations, as these are absolutely required for uppP2 catalytic activity .

  • Substrate Preparation: Due to the hydrophobic nature of the natural substrate (undecaprenyl pyrophosphate), shorter-chain analogs like farnesyl pyrophosphate may be used for initial characterization. For studies requiring the natural substrate, specialized methods for solubilizing and delivering the lipid substrate should be employed .

How can site-directed mutagenesis be effectively applied to study uppP2 structure-function relationships?

Site-directed mutagenesis is a powerful approach for investigating uppP2 structure-function relationships:

  • Target Selection Strategy:

    • Focus on conserved residues identified through multiple sequence alignments

    • Prioritize residues in the consensus motifs: (E/Q)XXXE, PGXSRSXXT, and the conserved histidine

    • Consider residues predicted to be in the membrane-water interface

    • Include control mutations outside the active site to validate specificity

  • Mutation Design Principles:

    • Conservative substitutions (e.g., E→D) to test the importance of specific chemical properties

    • Non-conservative substitutions (e.g., E→A) to completely remove functional groups

    • Double mutations to test cooperative effects, such as the E17A/E21A double mutant that showed complete loss of activity

  • Expression and Activity Assessment:

    • Express mutant variants under identical conditions

    • Verify proper folding and membrane insertion using biochemical assays

    • Compare kinetic parameters (kcat, Km) using standardized activity assays

    • Perform thermal stability assays to determine if mutations affect protein stability

A systematic approach examining multiple combinations of mutations can provide comprehensive insights into the catalytic mechanism and substrate binding determinants .

What computational approaches can predict substrate binding and catalytic mechanisms in uppP2?

Computational methodologies have significantly contributed to understanding uppP2:

  • Homology Modeling and Ab Initio Modeling:

    • The Rosetta membrane ab initio modeling program has been successfully applied to generate structural models of UPP phosphatases

    • Fragment-based approaches using 3 and 9 amino acid fragment databases help generate atomic models

    • Model filtering based on the proximity of key catalytic residues (e.g., Glu-21, His-30, and Arg-174) enhances model selection

  • Molecular Dynamics Simulations:

    • MD simulations in explicit membrane environments validate structural stability

    • Analysis of water penetration into the active site pocket provides insights into the hydrolysis mechanism

    • Identification of ion coordination sites explains the requirement for divalent cations

    • Calculation of binding free energies for substrate analogs aids inhibitor design

  • Docking Studies:

    • Molecular docking of substrate analogs like farnesyl pyrophosphate helps visualize substrate positioning

    • Energy minimization of enzyme-substrate complexes reveals critical interaction networks

These computational approaches should ideally be combined with experimental validation through mutagenesis and kinetic studies for a comprehensive understanding of uppP2 function .

How can researchers investigate the membrane topology and orientation of uppP2?

Understanding membrane topology is crucial for interpreting uppP2 function:

  • Experimental Approaches:

    • Cysteine accessibility methods: introducing cysteine residues at various positions and testing their accessibility to membrane-impermeable labeling reagents

    • Fluorescence quenching assays with brominated phospholipids to determine the depth of specific residues in the membrane

    • Protease protection assays to identify exposed loops

    • GFP fusion analysis: C-terminal and N-terminal GFP fusions can indicate cytoplasmic localization of these regions

  • Computational Predictions:

    • Transmembrane helical regions can be predicted using specialized algorithms like Phyre2 and Topcons

    • Integration of experimental constraints (e.g., N and C termini localized in the cytoplasm) with computational predictions improves accuracy

    • Assessment of the positive-inside rule, where positively charged residues are preferentially located on the cytoplasmic side of the membrane

Current evidence suggests that uppP2 has both N and C termini extending into the periplasm, with a pocket open to the periplasmic side, placing the active site accessible from the periplasm or periplasmic leaflet of the membrane .

How can uppP2 inhibitors be designed as potential antibacterial agents?

The essential nature of UPP phosphatases makes them attractive antibacterial targets:

  • Rational Inhibitor Design Strategy:

    • Focus on compounds that mimic the pyrophosphate moiety of the substrate

    • Target the magnesium/calcium binding site that's critical for catalysis

    • Explore lipophilic compounds that can access the membrane-embedded active site

    • Consider compounds that can simultaneously interact with multiple conserved residues (E17, E21, H30, R174)

  • Screening Approaches:

    • Develop high-throughput assays using synthetic fluorescent substrates

    • Utilize thermal shift assays to identify compounds that bind to and stabilize the enzyme

    • Employ computational virtual screening against the crystal structure

    • Consider fragment-based drug discovery to identify initial binding scaffolds

  • Considerations for Bacterial Specificity:

    • Target features unique to bacterial UPP phosphatases not found in human phosphatases

    • Address potential redundancy in UPP phosphatases (like UppP and BcrC in B. subtilis)

    • Explore synergistic effects with other cell wall synthesis inhibitors

Bacitracin, which binds UPP and prevents its recycling, demonstrates the antibacterial potential of targeting this pathway, though direct enzyme inhibitors might offer improved specificity .

What techniques can be used to investigate the kinetics and substrate specificity of uppP2?

Comprehensive kinetic characterization requires specialized techniques:

  • Substrate Preparation and Assay Methods:

    • Radiolabeled substrates: Using 32P-labeled UPP to directly measure dephosphorylation rates

    • Coupled enzyme assays: Linking phosphate release to colorimetric or fluorescent readouts

    • Direct chromatographic methods: HPLC separation of substrate and product

    • Fluorescence-based assays using synthetic fluorogenic substrates

  • Kinetic Parameter Determination:

    • Standard Michaelis-Menten analysis to determine Km and kcat values

    • Exploration of multiple substrate analogs to assess chain-length specificity

    • Determination of optimal pH, temperature, and ionic conditions

    • Investigation of metal ion requirements (Mg2+/Ca2+) and apparent binding constants

  • Inhibition Studies:

    • Competitive vs. non-competitive inhibition patterns

    • Product inhibition analysis to understand the reaction mechanism

    • Determination of IC50 and Ki values for potential inhibitors

Metal IonRelative Activity (%)Apparent Km (μM)kcat (s⁻¹)
Mg²⁺10027.3 ± 3.412.6 ± 0.5
Ca²⁺8731.2 ± 4.111.0 ± 0.7
None<5Not determinedNot determined

Table 1: Hypothetical kinetic parameters for uppP2 with different metal ions

How does the expression and function of uppP2 change under different growth conditions or antibiotic stress?

Understanding the regulation and stress response of uppP2:

  • Transcriptional Regulation:

    • Quantitative PCR to measure changes in uppP2 expression under different conditions

    • Promoter fusion studies to identify regulatory elements

    • ChIP-seq to identify transcription factors that bind the uppP2 promoter

    • Investigation of stress response regulons that control uppP2 expression

  • Post-translational Regulation:

    • Phosphoproteomics to identify potential regulatory phosphorylation sites

    • Chemical crosslinking to identify protein interaction partners

    • Assessing changes in localization under stress conditions

  • Response to Antibiotics:

    • Measure uppP2 expression changes in response to cell wall antibiotics

    • Determine if overexpression of uppP2 contributes to antibiotic resistance

    • Investigate the role of uppP2 in the bacterial stress response

Research in B. subtilis has shown that BcrC (one of the UPP phosphatases) is part of the σM-dependent cell envelope stress response, suggesting that bacteria upregulate UPP phosphatase activity under cell envelope stress conditions. This regulation likely helps maintain cell wall synthesis during environmental challenges or antibiotic exposure .

What are common challenges in expressing and purifying membrane proteins like uppP2?

Researchers frequently encounter specific obstacles when working with uppP2:

  • Expression Challenges and Solutions:

    • Protein aggregation: Use lower induction temperatures (16-20°C) and specialized E. coli strains designed for membrane protein expression

    • Toxicity to host cells: Employ tightly regulated expression systems and consider using C41/C43 E. coli strains developed for toxic membrane proteins

    • Low yields: Optimize codon usage for the expression host and consider fusion partners like bacteriorhodopsin that have been successful for uppP family proteins

    • Inclusion body formation: Evaluate different detergents for extraction or consider refolding protocols specific for membrane proteins

  • Purification Obstacles:

    • Protein instability: Include appropriate phospholipids during purification to stabilize the protein

    • Detergent selection: Screen multiple detergents for optimal extraction efficiency while maintaining activity

    • Aggregation during concentration: Use appropriate additives like glycerol or specific lipids to prevent aggregation

    • Loss of metal cofactors: Ensure buffers contain appropriate concentrations of Mg²⁺ or Ca²⁺

  • Activity Assessment Issues:

    • Development of reliable activity assays for detergent-solubilized protein

    • Proper handling of hydrophobic substrates

    • Accounting for background phosphatase activity in preparations

How can researchers differentiate between the activities of different UPP phosphatases in bacterial systems?

When studying bacterial systems with multiple UPP phosphatases:

  • Genetic Approaches:

    • CRISPR interference (CRISPRi) to selectively deplete individual phosphatases

    • Construction of clean deletion mutants and complementation studies

    • Creation of conditional mutants using inducible expression systems

  • Biochemical Discrimination:

    • Development of selective inhibitors for specific phosphatases

    • Substrate preference analysis to identify unique kinetic signatures

    • Antibody-based detection of specific phosphatases

    • Activity assays under conditions that preferentially favor one enzyme over others

  • Expression Analysis:

    • qRT-PCR to quantify mRNA levels of different phosphatases

    • Western blotting with phosphatase-specific antibodies

    • Reporter gene fusions to monitor expression patterns

    • Proteomics to quantify relative abundance of different phosphatases

Research in B. subtilis has successfully used an optimized CRISPRi system to demonstrate functional redundancy between UppP and BcrC phosphatases, showing that either enzyme alone is sufficient for viability but depletion of both is lethal .

What controls are essential when studying uppP2 enzymology?

Rigorous controls ensure reliable results when characterizing uppP2:

  • Essential Experimental Controls:

    • Catalytically inactive mutants (e.g., E17A/E21A) as negative controls for activity assays

    • Metal-free conditions (EDTA treatment) to demonstrate metal dependence

    • Heat-inactivated enzyme preparations to control for non-enzymatic hydrolysis

    • Background phosphate contamination assessment in all reagents

  • Substrate Purity Considerations:

    • Verification of substrate identity and purity by mass spectrometry

    • Handling procedures to prevent substrate degradation

    • Appropriate solubilization methods for lipid substrates

    • Controls for substrate stability under assay conditions

  • Protein Quality Verification:

    • Size exclusion chromatography to verify monodispersity

    • Circular dichroism to confirm secondary structure integrity

    • Thermal stability assays to assess protein folding

    • Detergent content analysis to ensure consistent micelle properties

Implementing these controls will help researchers distinguish genuine enzymatic activity from artifacts and ensure reproducible results across different experimental setups.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.