Recombinant Undecaprenyl-diphosphatase 3 (uppP3)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biological Role

Recombinant uppP3 performs the dephosphorylation reaction:

UPP+H2OUP+Phosphate\text{UPP} + \text{H}_2\text{O} \rightleftharpoons \text{UP} + \text{Phosphate}

This reaction recycles UPP—a byproduct of cell wall synthesis—into UP, which is reused to transport peptidoglycan precursors across the cell membrane . In Acinetobacter baylyi (strain ADP1), uppP3 also contributes to bacitracin resistance by competing with the antibiotic for UPP binding .

Functional Insights from Homologs

Studies on homologous UPP phosphatases provide context for uppP3’s role:

EnzymeOrganismKey FunctionPhenotype When Depleted
UppPEscherichia coliPrimary UPP recycling; periplasmic active site Cell lysis due to UPP accumulation
BcrCBacillus subtilisBackup UPP phosphatase; upregulated under cell envelope stress Synthetic lethality with UppP
YodMBacillus subtilisDiacylglycerol pyrophosphatase homolog; supports growth when overexpressed No standalone essentiality

Recombinant uppP3 likely shares functional redundancy with these homologs, ensuring UP availability even under stress .

Research Applications

  1. Antibiotic Target Validation
    UPP phosphatases are targeted by bacitracin, which sequesters UPP . Recombinant uppP3 facilitates in vitro screens for inhibitors that could potentiate existing antibiotics .

  2. Cell Envelope Stress Studies
    Depletion of UPP phosphatases in B. subtilis activates the σᴹ-dependent cell envelope stress response, causing morphological defects . Recombinant uppP3 enables analogous studies in Acinetobacter species.

  3. Enzyme Kinetics
    Activity assays using recombinant uppP3 can quantify Ca²⁺-enhanced hydrolysis rates, aiding mechanistic studies .

Outstanding Questions

  • Does uppP3 localize to the periplasm or cytoplasm in Acinetobacter?

  • What structural features distinguish uppP3 from UppP or BcrC?

  • Can uppP3 overexpression reverse bacitracin resistance in pathogenic strains?

These gaps highlight the need for crystallographic data and in vivo interaction studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, should you have specific format requirements, please indicate them during order placement. We will fulfill your needs accordingly.
Lead Time
Delivery timelines may vary depending on the purchase method and location. Kindly contact your local distributors for precise delivery information.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is preferred, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference point.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP3; bacA-3; bacA3; upk3; BA_0683; GBAA_0683; BAS0649; Undecaprenyl-diphosphatase 3; Bacitracin resistance protein 3; Undecaprenyl pyrophosphate phosphatase 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Bacillus anthracis
Target Names
uppP3
Target Protein Sequence
MEQFYYILKYLILGLFQGLTEPIPISSSGHLVLAQHLLGLKIEGFSFELLVNSASLLAVL LIYRNDLIRLTKNGLSYIFTRAEDAKSDFFFIIYLVIATIPAGVIGVLFKDYIDQYLKGV KMVGISLLITAVGLWIIRNLRGRRNDGDLSMKDAIIVGLAQACALIPGISRSGATIVAAM LLGMKQETALRFSFLLYIPVSLGGLLLSITDIAKDPNLDTLFVPYIVAFIATFIMTYISL KWFMNIMAKGNLKYFSFYCIIVGVLTLIFL
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links

KEGG: ban:BA_0683

STRING: 260799.BAS0649

Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological role of Undecaprenyl-diphosphatase in bacterial systems?

Undecaprenyl pyrophosphate phosphatase (UppP) serves as an integral membrane protein essential for recycling the lipid carrier required for ongoing biosynthesis of bacterial cell walls. UppP specifically regenerates undecaprenyl phosphate (C55-P) from undecaprenyl pyrophosphate (C55-PP), which becomes a side product after peptidoglycan building blocks are polymerized and transferred to the existing cell wall. This recycling mechanism is critical because interruption of the regeneration process leads to accumulation of cell wall intermediates and ultimately results in cell lysis . The importance of UppP cannot be overstated, as it represents a critical point in the cycle that maintains bacterial cell wall integrity, making it both a valuable research target and a potential antibiotic development candidate.

How does uppP3 differ from other isoforms in the undecaprenyl-diphosphatase family?

Undecaprenyl-diphosphatase exists in multiple isoforms, with uppP3 being one of the variants. While the core catalytic function of dephosphorylating undecaprenyl pyrophosphate remains consistent across isoforms, uppP3 demonstrates distinctive structural elements that influence its substrate specificity, membrane localization, and potentially its regulatory mechanisms. The crystal structure studies of UppP from Escherichia coli have revealed an inverted topology repeat that provides mechanistic insights into intramembranal phosphatase action . When designing experiments or interpreting results involving uppP3, researchers should account for these structural differences, as they may affect inhibitor binding profiles, catalytic efficiency, and physiological responses to environmental changes in different bacterial species or strains.

What are the structural characteristics of recombinant uppP3 that enable its function?

Recombinant uppP3, like other undecaprenyl pyrophosphate phosphatases, possesses specific structural characteristics that facilitate its function within the membrane environment. The crystal structure of UppP revealed at 2.0 Å resolution demonstrates an intramembranal mechanism for phosphatase action that relies on key structural motifs . The enzyme contains an inverted topology repeat that forms the foundation for substrate specificity. Additionally, researchers have identified structural motifs in UppP that share similarities with cross-membrane transporters, suggesting a potential secondary function as a flippase that may specifically relocalize the C55-P product back to the cytosolic space after dephosphorylation . Understanding these structural elements is crucial for experimental design related to site-directed mutagenesis, inhibitor development, and functional analyses of recombinant uppP3.

What expression systems are most effective for producing functional recombinant uppP3?

When expressing recombinant uppP3, researchers must carefully select expression systems that accommodate the challenges of membrane protein production. While E. coli expression systems provide ease of use and high yields, they may not always correctly fold complex membrane proteins like uppP3. For functional expression of uppP3, consider specialized E. coli strains with enhanced membrane protein expression capabilities or eukaryotic systems such as Pichia pastoris or insect cells that may provide a more suitable membrane environment for proper folding.

The expression protocol should include:

  • Codon optimization for the host organism

  • Use of appropriate solubilization tags or fusion partners

  • Temperature optimization (often lower temperatures improve folding)

  • Controlled induction protocols to prevent toxic accumulation

When extracting the recombinant protein, carefully select detergents that preserve the native conformation while effectively solubilizing the membrane protein. Validation of functionality should follow extraction through activity assays measuring phosphatase activity using undecaprenyl pyrophosphate substrates.

How can researchers effectively design cell-based screening platforms for uppP3 inhibitors?

Developing cell-based screening platforms for uppP3 inhibitors requires careful consideration of both the biological context and technical parameters. Building upon methods similar to those used for UppS inhibitor screening, researchers should establish platforms that specifically target uppP3 activity . A successful screening approach would include:

  • Development of bacterial strains with modified uppP3 expression levels

  • Implementation of reporter systems linked to cell wall integrity

  • Establishment of clear positive and negative controls for validation

  • Integration of counter-screens to eliminate compounds with off-target effects on membrane potential

For example, a validated screening platform for UppS identified the inhibitor MAC-0547630, which exhibits selective, nanomolar inhibition without off-target effects on membrane potential . A similar approach could be adapted for uppP3, focusing on its unique structural features. The screening should prioritize compounds that demonstrate selective inhibition with minimal impact on other cellular processes, particularly those affecting membrane integrity or causing general toxicity.

What purification strategies maximize yield and activity of recombinant uppP3?

Purifying recombinant uppP3 with maintained activity represents a significant challenge due to its membrane-embedded nature. An optimized purification strategy should include:

  • Initial solubilization using mild detergents (DDM, LMNG, or C12E8) to preserve the native conformation

  • Affinity chromatography using appropriately positioned tags (C-terminal tags often work better for membrane proteins)

  • Size exclusion chromatography to ensure homogeneity and remove aggregates

  • Lipid supplementation during purification to maintain the lipid environment necessary for activity

The purification process should be monitored at each step through activity assays to ensure that functional integrity is maintained. Consider using a table format to track purification efficiency:

Purification StepProtein Yield (mg/L culture)Specific Activity (nmol/min/mg)Purity (%)Recovery (%)
Crude Membrane---100
Solubilization----
Affinity----
Size Exclusion----

This table allows researchers to systematically optimize each purification step based on quantitative measurements of yield, activity, and purity.

How does the inverted topology repeat in uppP3 contribute to substrate specificity?

The inverted topology repeat observed in the crystal structure of UppP provides crucial insights into how these enzymes achieve substrate specificity within the membrane environment . This architectural feature creates a unique binding pocket that accommodates the long hydrophobic undecaprenyl chain while positioning the pyrophosphate group precisely at the catalytic site.

The inverted topology likely contributes to substrate specificity through:

  • Formation of a hydrophobic tunnel that specifically accommodates the C55 isoprenoid chain

  • Creation of a precise spatial arrangement of charged residues that recognize the pyrophosphate group

  • Establishment of conformational dynamics that facilitate substrate entry and product release

To investigate this feature experimentally, researchers should consider:

  • Site-directed mutagenesis targeting conserved residues within the repeat regions

  • Molecular dynamics simulations to understand conformational changes during substrate binding

  • Comparison studies with homologous enzymes having different substrate preferences

These approaches would help elucidate how structural elements within the inverted topology translate to functional specificity for undecaprenyl pyrophosphate over other similar lipid pyrophosphates.

What potential dual functions might uppP3 serve beyond phosphatase activity?

Recent structural analyses of UppP have revealed key structural motifs similar to those found in cross-membrane transporters, suggesting potential flippase functionality that could relocalize the C55-P product back to the cytosolic space . This dual functionality hypothesis warrants thorough investigation, as it may represent a more efficient cellular mechanism where a single protein performs both the dephosphorylation and translocation steps.

To investigate this potential dual role, researchers should design experiments that:

  • Assess membrane translocation of labeled C55-P in reconstituted proteoliposomes containing purified uppP3

  • Compare flippase activity in wild-type versus catalytically inactive uppP3 mutants

  • Conduct structural studies focusing on conformational changes associated with different functional states

  • Identify specific residues involved in potential flippase activity through mutagenesis

Understanding this potential dual functionality would significantly impact our comprehension of bacterial cell wall biosynthesis efficiency and could reveal new opportunities for antibiotic development targeting either the phosphatase activity, the potential flippase function, or both simultaneously.

How do environmental factors and membrane composition affect uppP3 activity?

As an integral membrane protein, uppP3's activity is likely highly influenced by its lipid environment and various environmental factors. Researchers investigating these influences should consider:

  • Membrane composition effects:

    • Systematically vary lipid compositions in reconstituted systems to assess activity changes

    • Evaluate the impact of membrane thickness, fluidity, and charge on enzyme kinetics

    • Determine if specific lipids act as allosteric modulators

  • Environmental factors:

    • pH dependency of catalytic activity across physiologically relevant ranges

    • Temperature effects on both stability and activity

    • Ionic strength and specific ion requirements for optimal function

  • Experimental approach:

    • Use reconstituted proteoliposomes with defined lipid compositions

    • Employ surface plasmon resonance to measure binding kinetics under various conditions

    • Utilize circular dichroism to assess structural stability across environmental conditions

These investigations would provide crucial insights into how uppP3 functions within the complex bacterial membrane environment and how its activity might be modulated in response to environmental changes or stresses.

How should researchers address data conflicts when analyzing uppP3 activity across different experimental systems?

When analyzing uppP3 activity across different experimental systems, researchers often encounter conflicting data that must be carefully resolved. Such conflicts may arise from variations in expression systems, purification methods, assay conditions, or data interpretation approaches . To systematically address these conflicts:

  • Identify the source of discrepancies:

    • Compare experimental methodologies in detail, including buffer compositions, detergents used, and assay conditions

    • Assess whether differences arise from technical variations or represent genuine biological phenomena

    • Determine if conflicting results occur at specific steps in the workflow

  • Resolution strategies:

    • Conduct side-by-side experiments using standardized protocols across different systems

    • Implement multiple, orthogonal activity assays to validate findings

    • Consider the influence of post-translational modifications or structural alterations in different expression systems

  • Documentation and reporting:

    • Maintain comprehensive records of all experimental parameters

    • Report conflicts transparently in publications, including potential explanations

    • Provide sufficient methodological detail to enable reproduction by other researchers

By systematically analyzing the sources of data conflicts, researchers can develop a more nuanced understanding of uppP3 behavior and identify conditions that optimize its functional characterization.

What statistical approaches are most appropriate for analyzing kinetic data from uppP3 enzymatic assays?

Analyzing kinetic data from uppP3 enzymatic assays requires careful statistical treatment to account for the unique challenges presented by membrane protein biochemistry. When working with uppP3:

  • Model selection:

    • Determine whether standard Michaelis-Menten kinetics apply or if more complex models (substrate inhibition, allosteric regulation) are needed

    • Use Akaike Information Criterion (AIC) or similar approaches to objectively select the most appropriate kinetic model

    • Consider enzyme behavior in detergent micelles versus native membrane environments

  • Dealing with variability:

    • Implement robust regression methods that are less sensitive to outliers

    • Use appropriate transformations (log, Box-Cox) when data violate statistical assumptions

    • Consider mixed-effects models when analyzing data across multiple experimental batches

  • Validation approaches:

    • Perform residual analysis to assess model adequacy

    • Conduct sensitivity analyses to determine how parameter estimates change with different statistical approaches

    • Use bootstrap resampling to generate confidence intervals for kinetic parameters

By employing these rigorous statistical approaches, researchers can extract reliable kinetic parameters from uppP3 assays, enabling more accurate comparisons between experimental conditions and mutant variants.

How can researchers effectively present complex uppP3 structural and functional data in publications?

Presenting complex structural and functional data for uppP3 in publications requires thoughtful organization and visualization strategies. Following best practices for data presentation:

  • Data table design:

    • Create clearly titled tables that relate directly to the specific data being presented

    • Organize columns logically, typically with the manipulated variable in the left column, raw data in the middle columns, and processed data (averages, standard deviations) in the right columns

    • Include appropriate units and measurement uncertainty for all raw data

    • Maintain consistent precision across all numerical values (same number of decimal places/significant digits)

  • Structural data visualization:

    • Present multiple views of the protein structure highlighting key functional regions

    • Use consistent color coding across all structural representations

    • Include schematic diagrams illustrating proposed mechanisms or conformational changes

    • Consider interactive or supplementary materials for complex structural datasets

  • Integration of multiple data types:

    • Create composite figures that integrate structural, kinetic, and functional data

    • Develop clear visual hierarchies to guide readers through complex datasets

    • Use annotations to emphasize critical connections between different data types

Effective presentation ensures that the significance of uppP3 research is clearly communicated and facilitates accurate interpretation by the scientific community.

How can computational approaches enhance uppP3 structure-function studies?

Computational approaches offer powerful tools to enhance understanding of uppP3 structure-function relationships, particularly given the challenges of membrane protein research. Researchers should consider:

  • Molecular dynamics simulations:

    • Simulate uppP3 behavior within realistic membrane environments

    • Investigate conformational changes during substrate binding, catalysis, and product release

    • Examine water and ion movements through the protein during the catalytic cycle

  • Machine learning applications:

    • Develop predictive models for inhibitor binding based on structural features

    • Identify patterns in sequence-structure-function relationships across bacterial species

    • Automate analysis of large-scale screening data to identify promising lead compounds

  • Quantum mechanics/molecular mechanics (QM/MM) approaches:

    • Model the electronic structure of the active site during catalysis

    • Calculate energy barriers for the phosphate hydrolysis reaction

    • Predict effects of mutations on catalytic efficiency with atomistic detail

These computational approaches can guide experimental design, provide mechanistic insights difficult to obtain experimentally, and accelerate the development of selective inhibitors targeting uppP3.

What are the most promising approaches for studying uppP3 in native membrane environments?

Studying uppP3 in its native membrane environment presents significant challenges but offers critical insights unavailable from detergent-solubilized systems. Emerging approaches include:

  • Native nanodiscs and lipid bilayer systems:

    • Reconstitute uppP3 into nanodiscs with native or defined lipid compositions

    • Employ styrene-maleic acid lipid particles (SMALPs) to extract uppP3 with its surrounding lipid environment

    • Develop tethered bilayer systems for electrical measurements of potential flippase activity

  • Advanced microscopy techniques:

    • Implement single-molecule fluorescence microscopy to track individual uppP3 molecules

    • Use high-speed atomic force microscopy to observe conformational dynamics in real-time

    • Apply cryo-electron microscopy to capture different functional states in near-native conditions

  • In-cell approaches:

    • Develop FRET-based sensors to monitor uppP3 activity in living bacteria

    • Employ genetic code expansion to introduce site-specific probes at key positions

    • Use chemical biology approaches to selectively label and track uppP3 and its substrates

These approaches enable researchers to study uppP3 function within its natural context, providing insights that more accurately reflect its behavior in bacterial cells.

How might advances in mass spectrometry contribute to understanding post-translational modifications of uppP3?

Mass spectrometry (MS) techniques can provide crucial insights into post-translational modifications (PTMs) that may regulate uppP3 activity, an area that remains largely unexplored. Researchers should consider:

  • Sample preparation strategies:

    • Optimize extraction protocols to maintain PTMs during purification

    • Develop enrichment strategies for modified peptides

    • Compare PTM profiles across different growth conditions and bacterial strains

  • Advanced MS techniques:

    • Implement top-down proteomics to analyze intact uppP3 and its modification states

    • Utilize targeted approaches such as parallel reaction monitoring for quantification of specific modifications

    • Apply ion mobility separation to distinguish structural isomers of modified peptides

  • Functional correlation:

    • Correlate identified PTMs with enzymatic activity under various conditions

    • Employ site-directed mutagenesis to mimic or prevent specific modifications

    • Investigate potential regulatory enzymes responsible for adding or removing PTMs

Understanding the PTM landscape of uppP3 could reveal regulatory mechanisms and potential new approaches for modulating its activity in bacterial systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.