Recombinant Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
uppP; bacA; upk; WS1290; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-256
Protein Length
full length protein
Species
Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) (Vibrio succinogenes)
Target Names
uppP
Target Protein Sequence
MDIFHAIILGIVEGLTEFLPVSSTGHLILVSELLGIKQDDFHKTFEISIQLGSILAVLAL FRERLFSGVDIWLKLAVAFIPTGALGFLLYKHVKALFAPSTVAYALILGGIVFLVLEWLH KDKEYKINSVESIGYKEALAIGFFQALAMIPGTSRSGSTIVGGLILGLNRKVAAEFSFLL ALPTMFIATGYDLYKNSHTLSIENLSALGVGFVVAFIFAMIAVKGFLKFISRFNFVPFGI YRIILGIIFLFYLDLI
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) and confers bacitracin resistance.
Database Links

KEGG: wsu:WS1290

STRING: 273121.WS1290

Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what role does it play in bacterial cell wall biosynthesis?

Undecaprenyl-diphosphatase (UppP) is an integral membrane protein that catalyzes the conversion of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP). This conversion is a critical step in bacterial cell wall synthesis, as UP serves as the essential lipid carrier that ferries cell wall precursors across the cytoplasmic membrane. The role of UppP is fundamental to the lipid II cycle, one of the most frequently targeted processes for antibiotics. The dephosphorylation reaction catalyzed by UppP generates the monophosphate form (UP), which acts as a membrane "anchor" for the formation of peptidoglycan and wall teichoic acid synthases, critical components of the bacterial cell envelope .

What are the genetic redundancies in UPP phosphatase activity in bacteria?

Bacterial species often maintain redundant UPP phosphatases to ensure the essential process of cell wall synthesis continues even if one enzyme is compromised. In Bacillus subtilis, two UPP phosphatases—UppP and BcrC—form a synthetic lethal gene pair, meaning the bacteria requires at least one of these enzymes for viability. Recent research using CRISPR interference (CRISPRi) has demonstrated that depletion of both enzymes disrupts cell envelope biosynthesis. Additionally, a third predicted lipid phosphatase, YodM, which shows homology to diacylglycerol pyrophosphatases, can also support growth when overexpressed, providing a tertiary backup mechanism for this critical cellular function .

Why is UppP considered a potential antibiotic target?

UppP is considered an attractive antibiotic target for several compelling reasons. First, it is essential for bacterial viability across many species, as demonstrated by the lethal effects of depleting UPP phosphatase activity. Second, the enzymes involved in this pathway, including UppP, are not used by humans, reducing the potential for off-target effects and toxicity. Third, depletion of UppP leads to morphological defects consistent with a failure of cell envelope synthesis, which is lethal to bacteria. Finally, inhibition of this pathway strongly activates stress responses, further compromising bacterial survival. These characteristics make UppP a promising target for the development of novel antibiotics to combat the growing problem of antibiotic resistance .

What are the key structural features of UppP and how do they contribute to its function?

The structure of UppP contains two consensus regions critical for its phosphatase activity: glutamate-rich (E/Q)XXXE motifs and PGXSRSXXT motifs. These regions, along with a key histidine residue, form the catalytic core of the enzyme. Molecular dynamics simulations and mutagenesis studies have confirmed the importance of these motifs for enzymatic function. The enzyme's structure positions these catalytic residues at the aqueous interface of the membrane, optimally positioned to interact with the lipid substrate undecaprenyl pyrophosphate. This structural arrangement allows UppP to effectively catalyze the dephosphorylation reaction while remaining embedded in the bacterial membrane, where its substrate is located .

Where is the active site of UppP located in the bacterial cell?

Based on predictive modeling and experimental evidence, the active site of UppP is oriented toward the periplasmic side of the bacterial plasma membrane. Two-dimensional structure predictions show that the consensus regions containing the (E/Q)XXXE and PGXSRSXXT motifs, as well as the critical histidine residue, are localized near the aqueous interface of UppP and oriented toward the periplasmic site. This localization implies that the biological function of UppP operates on the outer side of the plasma membrane, which aligns with the topology of the cell wall biosynthesis pathway. This periplasmic orientation is significant because it positions the enzyme to interact with its substrate as part of the broader cell wall synthesis machinery .

How has the three-dimensional model of UppP been constructed and validated?

The three-dimensional model of UppP has been constructed using the Rosetta membrane ab initio method, a sophisticated computational approach for modeling membrane proteins. The modeling process begins with generating two-fragment databases (3 and 9 amino acids) using the Rosetta Fragment Libraries server. These fragments are then assembled to generate atomic models, with constraints ensuring that no non-helical secondary structure fragments are placed in the predicted transmembrane regions. The process involves Monte Carlo-based membrane normal cycles with specific parameters: 40 total cycles, a membrane normal angle search step size of 15°, and a center search step size of 2 Å. The resulting models are filtered based on spatial criteria, specifically that the Cα positions of three key residues (Glu-21, His-30, and Arg-174) are within a 10 Å diameter sphere. The final selection of models is based on those that feature a viable active site pocket, validated through manual inspection and correlation with experimental mutagenesis data .

What methods can be used to express and purify recombinant UppP?

Recombinant UppP can be successfully expressed and purified using a bacteriorhodopsin fusion tag system. The protocol begins with transforming an expression vector harboring the Hmbop1/D94N-uppP gene into Escherichia coli C41 (DE3). Bacterial cultures are grown at 37°C in LB medium containing 100 mg/ml ampicillin until reaching an A600 of approximately 0.9. At this point, protein expression is induced by adding 0.5 mM isopropyl β-d-thiogalactoside and 5–10 mM all-trans-retinal, followed by a 5-hour incubation at 37°C. For purification, cells are harvested and resuspended in buffer A (50 mM Tris, pH 7.5, 500 mM NaCl), then disrupted using Constant Cell Disruption Systems. The membrane fraction is collected by ultracentrifugation at 40,000 rpm for 1.5 hours, and the pellet is solubilized in buffer A with 1% (w/v) n-dodecyl-β-D-maltopyranoside (DDM). This approach has proven effective for obtaining functionally active UppP for subsequent biochemical and structural studies .

How can UppP activity be measured in vitro?

UppP activity can be measured in vitro through a phosphate release assay that quantifies the amount of phosphate liberated during the enzymatic reaction. The standard assay mixture contains 50 mM Hepes (pH 7.0), 150 mM NaCl, 10 mM MgCl2, 0.02% DDM, 35 mM farnesyl pyrophosphate (Fpp) as the substrate, and 20 nM purified UppP. The reaction is incubated at 37°C and then quenched by adding 30 μl of Malachite Green reagent, which forms a colored complex with the released phosphate. The absorbance is measured at 650 nm, and the phosphate concentration is quantified based on a standard phosphate curve. This method allows researchers to determine the enzyme's kinetic parameters, including Km and kcat values, by varying substrate concentrations (typically 0.3–57 μM Fpp) and using 20–40 nM UppP. The initial velocity data are fitted to the Michaelis-Menten equation using computational software such as KaleidaGraph to derive the kinetic parameters .

What are the optimal conditions for UppP enzymatic assays?

The optimal conditions for UppP enzymatic assays have been determined through systematic experimentation. The enzyme exhibits optimal activity at pH 7.0, maintained using 50 mM Hepes buffer. The reaction requires specific ionic conditions, including 150 mM NaCl for ionic strength and 10 mM MgCl2 as a cofactor for enzymatic activity. The detergent environment is critical for maintaining the solubility and activity of this membrane protein, with 0.02% DDM (n-dodecyl-β-D-maltopyranoside) being the preferred choice. The assay is typically performed at 37°C, which represents the physiological temperature for bacterial growth. For determining pH-dependent activity profiles, researchers can use various buffer systems: sodium acetate (pH 5–6), Hepes (pH 6.5–8), and Tris-HCl (pH 9). These optimized conditions ensure reproducible and reliable measurement of UppP activity across different experimental settings and allow for accurate comparison of wild-type and mutant enzyme forms .

How does UppP inhibition affect bacterial cell wall synthesis and cell morphology?

Inhibition of UppP activity directly disrupts the lipid II cycle, which is essential for bacterial cell wall synthesis. When UppP is inhibited, the conversion of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP) is blocked, leading to a deficiency in the UP carrier lipid required for peptidoglycan and wall teichoic acid synthesis. This deficiency manifests as distinctive morphological defects consistent with a failure of cell envelope synthesis. In Bacillus subtilis, depletion of UPP phosphatase activity through CRISPRi-mediated repression of both uppP and bcrC genes leads to severe growth defects and abnormal cell morphology. Additionally, UppP inhibition strongly activates the σM-dependent cell envelope stress response, a bacterial mechanism to cope with cell wall damage. This stress response includes upregulation of bcrC, which encodes one of the UPP phosphatases, representing a compensatory mechanism that bacteria employ to mitigate the effects of phosphatase inhibition .

How can CRISPR-based technologies advance UppP research?

CRISPR-based technologies, particularly CRISPR interference (CRISPRi), have proven instrumental in advancing UppP research by enabling precise manipulation of gene expression in bacteria. An optimized CRISPRi system using catalytically inactive ("dead") CRISPR-associated protein 9 (dCas9)-based transcriptional repression allows researchers to investigate synthetic lethal gene pairs like uppP and bcrC. This approach offers several advantages over traditional gene knockout methods, particularly for studying essential genes or functionally redundant genes whose simultaneous deletion would be lethal. By using CRISPRi to selectively deplete UPP phosphatases, researchers have demonstrated the essential nature of this enzymatic activity and characterized the resulting phenotypic effects. The technology also facilitates the study of compensatory mechanisms, such as the ability of YodM to support growth when overexpressed in the absence of the primary UPP phosphatases. These capabilities make CRISPR-based technologies powerful tools for dissecting the complex roles of UppP and related enzymes in bacterial cell wall biosynthesis .

What is the relationship between UppP and bacterial antibiotic resistance mechanisms?

UppP plays a significant role in bacterial antibiotic resistance, particularly for antibiotics targeting cell wall biosynthesis. The σM-dependent cell envelope stress response, which is strongly activated upon UppP depletion, includes genes involved in antibiotic resistance. One such gene is bcrC, which not only functions as a UPP phosphatase but also contributes to bacitracin resistance (hence its name: bacitracin resistance protein C). The regulatory connection between UppP activity and stress response pathways illustrates how bacteria can adapt to cell wall-targeting antibiotics by modulating UPP phosphatase expression. Additionally, inhibitors targeting enzymes in the same pathway, such as UPPS (undecaprenyl diphosphate synthase), have shown promising antimicrobial activity. Some compounds, like benzoic acid derivatives, may inhibit both UPPS and UPPP (UppP), offering potential for dual-targeting antibiotics that could reduce the likelihood of resistance development. Understanding these relationships is crucial for developing new therapeutic strategies to combat antibiotic-resistant bacteria .

What screening methods exist for identifying UppP inhibitors?

Several screening methods have been developed to identify potential UppP inhibitors for antimicrobial development. One approach leverages the link between late-stage wall teichoic acid inhibition and Und-P production in Gram-positive bacteria to create cell-based small-molecule screening platforms. Such a platform was used to screen a chemical collection of 142,000 small molecules, resulting in the identification of six new inhibitors of UppS (undecaprenyl diphosphate synthase), an enzyme in the same pathway as UppP. Another screening approach involves testing compounds for their ability to inhibit UppP enzymatic activity in vitro, measuring phosphate release as described in the enzymatic assay methods. Structure-activity relationship studies have also been conducted, particularly with benzoic acid derivatives, to identify properties that correlate with UppP inhibition. The correlation between enzyme inhibition and bacterial growth inhibition is analyzed to determine which compounds are most promising for further development. These approaches can be combined with inhibitor testing against related enzymes (like FPPS and UPPS) to identify specificity and potential for dual-targeting .

Inhibition Testing ParameterMeasurement MethodTypical Evaluation Metrics
Enzymatic inhibition (IC50)Phosphate release assayConcentration achieving 50% inhibition
Bacterial growth inhibition (MIC)Broth dilution methodMinimum inhibitory concentration
Enzyme/cell correlationStatistical analysisPearson correlation coefficient (r)
Compound specificityMultiple enzyme assaysRelative IC50 values across enzymes
Membrane effectsMembrane potential assaysDepolarization measurements

How can site-directed mutagenesis help understand UppP function?

Site-directed mutagenesis is a powerful technique for understanding UppP function by systematically altering specific amino acids and examining the resulting effects on enzymatic activity. This approach has been instrumental in identifying key residues within the conserved motifs of UppP. By creating point mutations in the (E/Q)XXXE and PGXSRSXXT motifs, as well as the critical histidine residue, researchers can assess how these changes affect enzyme kinetics, substrate binding, and catalytic efficiency. For example, mutations in the glutamate residues of the (E/Q)XXXE motif typically result in substantially reduced enzymatic activity, confirming their role in catalysis. The experimental workflow begins with designing primers for site-directed mutagenesis, followed by PCR amplification, DpnI digestion to remove template DNA, and transformation into expression hosts. The mutant proteins are then expressed, purified, and characterized using the enzymatic assays described earlier. By comparing the kinetic parameters (Km and kcat values) of wild-type and mutant enzymes, researchers can make detailed inferences about the functional contributions of specific residues and refine structural models of the enzyme active site .

What computational methods are used to study UppP structure and function?

Computational methods play an essential role in studying UppP structure and function, especially given the challenges of experimentally determining membrane protein structures. The Rosetta membrane ab initio method has been used to predict the three-dimensional structure of UppP, generating models that provide insights into the spatial arrangement of key residues and potential substrate binding sites. Molecular dynamics simulations further refine these models by simulating the behavior of the protein in a lipid bilayer environment, allowing researchers to observe conformational changes and potential interaction mechanisms. Sequence alignment tools identify conserved motifs across different bacterial species, highlighting evolutionarily conserved regions likely critical for function. Docking simulations help predict how substrates and potential inhibitors interact with the enzyme active site, guiding structure-based drug design efforts. Quantitative structure-activity relationship (QSAR) analyses correlate the structural features of inhibitor compounds with their activity, informing the design of more potent and specific inhibitors. These computational approaches complement experimental methods and accelerate the discovery and development of UppP-targeting antimicrobials .

What are the current limitations in UppP research and how might they be addressed?

Despite significant progress, UppP research faces several limitations that challenge further advancement. One major obstacle is the difficulty in obtaining high-resolution crystal structures of membrane proteins like UppP, which hampers structure-based drug design efforts. This limitation could be addressed through advanced techniques such as cryo-electron microscopy or lipidic cubic phase crystallization, which have shown success with other membrane proteins. Another challenge lies in the genetic redundancy of UPP phosphatases in many bacteria, which complicates the assessment of phenotypic effects when targeting a single enzyme. Enhanced CRISPR-based technologies for simultaneous gene repression or deletion could help overcome this limitation. Additionally, the development of UppP-specific inhibitors faces challenges in achieving selectivity and avoiding off-target effects on membrane integrity. This issue might be addressed through more sophisticated screening methods that specifically test for membrane disruption effects. Finally, translating in vitro findings to in vivo efficacy represents a significant hurdle, requiring improved animal models of infection that better recapitulate human disease conditions .

How does UppP research contribute to understanding bacterial cell envelope homeostasis?

UppP research provides critical insights into bacterial cell envelope homeostasis by elucidating the mechanisms that maintain the supply of undecaprenyl phosphate, a limiting resource in cell wall synthesis. The study of UppP and related phosphatases has revealed intricate regulatory networks that respond to cell envelope stress, particularly the σM regulon in Bacillus subtilis. When UPP phosphatase activity is compromised, the resulting stress activates compensatory mechanisms, including upregulation of bcrC, which encodes one of the UPP phosphatases. This feedback loop demonstrates how bacteria maintain cell envelope integrity under stress conditions. Furthermore, the synthetic lethality of uppP and bcrC highlights the essential nature of UPP phosphatase activity and its non-redundant role in cell envelope synthesis. Understanding these homeostatic mechanisms provides a more comprehensive picture of bacterial physiology and potential vulnerabilities that could be exploited for antimicrobial development. Additionally, the connection between UppP function and wall teichoic acid synthesis underscores the interconnected nature of various cell envelope biosynthetic pathways, reinforcing the complexity of bacterial cell envelope homeostasis .

What are the most promising approaches for developing UppP-targeted antibiotics?

Development of UppP-targeted antibiotics represents a promising frontier in combating antibiotic resistance. Several approaches show particular potential in this area. First, structure-guided design based on increasingly refined models of UppP can lead to inhibitors that precisely target the enzyme active site. Second, dual-targeting strategies that simultaneously inhibit multiple enzymes in the cell wall biosynthesis pathway, such as UppP and UPPS, could reduce the likelihood of resistance development. The benzoic acid derivatives described in recent research exemplify this approach, showing activity against both enzymes. Third, combination therapy using UppP inhibitors alongside existing antibiotics that target other steps in cell wall synthesis could yield synergistic effects. Fourth, leveraging bacterial stress responses induced by UppP inhibition might enhance the efficacy of other antimicrobials. Finally, the development of prodrug approaches could improve the delivery of UppP inhibitors across the bacterial outer membrane in Gram-negative pathogens. One particularly notable example is MAC-0547630, which exhibits selective, nanomolar inhibition against UppS without off-target effects on membrane potential, making it a unique chemical probe for exploring enzyme inhibition in bacterial cell systems. Such compounds provide valuable starting points for the development of next-generation antibiotics .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.