Recombinant Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Description

Definition of Recombinant Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose Transferase (ArnC)

Recombinant Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase, commonly referred to as ArnC, is an integral membrane protein that plays a crucial role in bacterial lipopolysaccharide (LPS) biosynthesis . Specifically, ArnC catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate, which generates Und-P-L-Ara4FN . The modified arabinose is then attached to lipid A and is required for polymyxin resistance in Gram-negative pathogens .

ArnC Tetramer Formation

ArnC forms a stable tetramer with C2 symmetry through interactions in the C-terminal region, which is expected to protrude into the cytosol . The β8 strand inserts into the adjacent protomer . ArnC protomers have two distinct types of interfaces involving multiple hydrogen bonds and salt bridges .

UDP Binding and Conformational Changes

ArnC catalyzes the transfer of UDP-L-Ara4N from the cytosol to produce UndP-Ara4FN in the inner membrane . Cryo-EM analysis of ArnC incubated with Mn2+ and UDP revealed a ligand-bound state of ArnC with the A-loop, spanning 201 to 213, in a closed conformation . UDP binding involves 14 amino acid residues from the ArnC IH1/2 and A-loop, suggesting the location of the sugar-binding site in this protein .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
arnC; WIGBR1590; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-323
Protein Length
full length protein
Species
Wigglesworthia glossinidia brevipalpis
Target Names
arnC
Target Protein Sequence
MLNFKKLSIIIPVYNEQDSLIELIKRTVNTCSKLKIKYEIIIIDDGSNDKSINILEKEAL KQNSKIVAIFLKKNYGQHSAIMAGFKHSSGDLVITMDADLQNPPEEIPKLILNAEKGYDV IGTFRQNRKDNWFRKISSRLINIIIQIVIGKSMKDYGCMLRAYNRNIINSILEYNKKNIF IPILANTLSKNIIEIPVLHYEREFGCSKYNLIKLIKLIYDLFFCISFNLIKKNKMFNIFI ILIFLAVLMSIVFFFIFFLKIKLNIFYKILFIPIIITLFLIKSFIIIILKILIDIFFVKA KKNSIYYINKIIKNNFSKKKDVT
Uniprot No.

Target Background

Function

Recombinant Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (ArnC) catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to bacterial resistance against polymyxin and cationic antimicrobial peptides.

Database Links

KEGG: wbr:b2254

STRING: 36870.WGLp159

Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)?

Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) is a membrane-bound glycosyltransferase that catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose (Ara4FN) from UDP to undecaprenyl phosphate . It is classified as a type-2 glycosyltransferase (GT-2) with the EC number 2.4.2.53 and is localized to the bacterial inner membrane . Recent cryo-EM studies have revealed that ArnC from Salmonella typhimurium forms a stable tetramer with C2 symmetry and comprises three distinct regions: an N-terminal glycosyltransferase domain, a transmembrane region, and interface helices (IHs) . The enzyme plays a critical role in the lipid A modification pathway that contributes to bacterial resistance to polymyxins and other cationic antimicrobial peptides .

What is the function of ArnC in bacterial resistance mechanisms?

ArnC functions as part of the pmrE(ugd) loci and the arnBCDTEF operon, which together mediate the addition of 4-amino-4-deoxy-L-arabinose (L-Ara4N) to the lipid A component of bacterial outer membrane lipopolysaccharides (LPS) . This modification neutralizes the negative charge of lipid A, reducing the binding affinity of polymyxins and other cationic antimicrobial peptides, thus conferring resistance .

Specifically, ArnC catalyzes the transfer of the formylated form of L-Ara4N (Ara4FN) from UDP to undecaprenyl phosphate, creating an intermediate that is processed further in the pathway before the final attachment of L-Ara4N to lipid A . The modified arabinose is attached to lipid A and is required for resistance to polymyxin and cationic antimicrobial peptides in both Escherichia coli and Salmonella typhimurium .

How is ArnC structurally organized?

Based on recent cryo-EM studies of Salmonella typhimurium ArnC, the protein has a three-part structure :

  • An N-terminal glycosyltransferase domain that contains the catalytic machinery

  • A transmembrane region that anchors the protein to the inner membrane

  • Interface helices (IHs) that participate in oligomerization and substrate binding

The functional form of ArnC is a tetramer with C2 symmetry, where the C-terminal β8 strand of each protomer inserts into the adjacent protomer, stabilizing the quaternary structure . ArnC protomers have two distinct types of interfaces involving multiple hydrogen bonds and salt bridges . The enzyme has a conserved DxD motif (100DADLQ104) that is characteristic of GT-2 family enzymes and is involved in coordinating divalent cations for nucleotide sugar binding .

What experimental methods are used to study ArnC?

Researchers employ various experimental approaches to study ArnC, including:

  • Structural biology techniques:

    • Cryo-electron microscopy (cryo-EM) single particle reconstruction has been used to determine the structures of Salmonella typhimurium ArnC in both apo and UDP-bound forms at resolutions of 2.75 Å and 3.8 Å, respectively .

    • Comparative structural analysis with homologs like GtrB and DPMS provides insights into catalytic mechanisms .

  • Biochemical assays:

    • In vitro enzyme activity assays to measure the transfer of Ara4FN from UDP to undecaprenyl phosphate .

    • Binding studies with UDP and divalent cations like Mn2+ .

  • Genetic approaches:

    • Deletion studies in E. coli have shown that inactivation of the arnC gene decreases the levels of UndP-Ara4FN and compromises polymyxin resistance .

    • Complementation experiments to verify gene function in vivo .

  • Recombinant protein production:

    • Expression and purification of recombinant ArnC for in vitro studies and structural analysis .

What conformational changes occur in ArnC upon UDP binding?

Cryo-EM studies of ArnC from Salmonella typhimurium in both apo and UDP-bound forms have revealed significant conformational changes upon ligand binding . The binding of UDP induces stabilization of the structurally labile A-loop (residues 201-213), which adopts a closed conformation in the bound state . Additionally, UDP binding causes a shift in the position of interface helices IH1 and IH2, with IH2 moving toward the UDP binding pocket .

These conformational changes result in an RMSD of 2.46 Å and a TM-score of 0.88 between the bound and unbound structures . The UDP binding pocket involves 14 amino acid residues from the IH1/2 regions and the A-loop, suggesting the location of the sugar-binding site . Moreover, UDP binding appears to symmetrize the tetrameric arrangement, leading to greater similarities in the interfaces between ArnC protomers .

What are the key catalytic residues in ArnC and how do they compare to other GT-2 family enzymes?

ArnC contains several key catalytic residues typical of GT-2 family glycosyltransferases. The DxD motif (100DADLQ104) is highly conserved and is involved in coordinating divalent cations (like Mn2+) that facilitate binding of the diphosphate group of the UDP-sugar donor .

Comparative analysis with structural homologs GtrB from Synechocystis and DPMS from Pyrococcus furiosus reveals similar catalytic architectures despite limited sequence identity . The structure of the ArnC protomer is most similar to that of GtrB, with these protomers sharing a similar topology and can be superimposed with a RMSD of 3.5 Å across 307 Cα atoms .

The A-loop (residues 201-213) in ArnC plays a crucial role in substrate binding and catalysis, becoming ordered upon UDP binding . The UDP binding pocket involves 14 amino acid residues from the IH1/2 and A-loop regions .

What methodological approaches can be used to study the membrane topology of ArnC?

Investigating the membrane topology of ArnC requires specialized techniques due to its integral membrane nature. Researchers can employ:

  • Cysteine scanning mutagenesis and accessibility studies:

    • Introduction of single cysteine residues throughout the protein sequence

    • Treatment with membrane-permeable and membrane-impermeable sulfhydryl reagents

    • Analysis of labeling patterns to determine which regions are cytoplasmic, transmembrane, or periplasmic

  • Fusion protein approaches:

    • Creation of fusion proteins with reporter tags (e.g., GFP, alkaline phosphatase, β-lactamase)

    • Analysis of reporter activity to determine orientation relative to the membrane

  • Protease protection assays:

    • Preparation of inverted membrane vesicles or proteoliposomes

    • Treatment with proteases under various conditions

    • Identification of protected fragments by mass spectrometry or immunoblotting

  • Cryo-electron tomography:

    • Visualization of ArnC in its native membrane environment

    • Determination of the orientation and depth of insertion in the lipid bilayer

  • Molecular dynamics simulations:

    • In silico assessment of protein-lipid interactions

    • Prediction of stable transmembrane orientations and membrane deformations

These methods would complement the existing cryo-EM structural data on ArnC and provide insights into how the enzyme interacts with its substrates at the membrane interface.

How can recombinant ArnC be optimally expressed and purified for structural and functional studies?

Successful expression and purification of recombinant ArnC require specialized approaches for membrane proteins. A comprehensive protocol would include:

  • Expression system selection:

    • Escherichia coli with specialized strains (C41, C43, Lemo21) for membrane protein expression

    • Alternative systems like Pichia pastoris or insect cells for problematic constructs

    • Codon-optimization of the gene for the expression host

  • Expression optimization:

    • Testing different fusion tags (His, MBP, SUMO) at N- or C-terminus

    • Evaluation of various induction parameters (temperature, inducer concentration, time)

    • Supplementation with specific lipids or additives to enhance stability

  • Membrane extraction:

    • Selection of appropriate detergents (DDM, LMNG, GDN) for ArnC solubilization

    • Screening of detergent concentration and solubilization time

    • Alternative approaches using styrene-maleic acid copolymer (SMA) for native lipid environment preservation

  • Purification strategy:

    • Initial capture using affinity chromatography (IMAC for His-tagged constructs)

    • Secondary purification using size exclusion chromatography to isolate tetrameric species

    • Optional intermediate steps like ion exchange or affinity purification

  • Quality assessment:

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to confirm tetrameric state

    • Thermal stability assays using differential scanning fluorimetry

    • Activity assays to confirm functional integrity

The purified protein can then be used for structural studies by cryo-EM or crystallography, biochemical characterization, or inhibitor screening campaigns.

How can the enzymatic activity of ArnC be measured in vitro?

Measuring the glycosyltransferase activity of ArnC presents several challenges due to its membrane-associated nature and complex substrates. Researchers can employ multiple complementary approaches:

  • Radiometric assays:

    • Use of 14C or 3H-labeled UDP-Ara4FN as donor substrate

    • Extraction of lipid products using organic solvents

    • Quantification of radiolabeled UndP-Ara4FN by scintillation counting

  • HPLC-based methods:

    • Preparation of UDP-Ara4FN with a fluorescent or UV-absorbing tag

    • Separation of reaction products by reverse-phase HPLC

    • Quantification based on decrease in donor substrate or increase in UndP-Ara4FN

  • Coupled enzyme assays:

    • Detection of UDP released during the reaction using UDP-glucose pyrophosphorylase and glucose-6-phosphate dehydrogenase

    • Measurement of NADH production spectrophotometrically at 340 nm

  • Mass spectrometry approaches:

    • Direct detection of reaction products using LC-MS/MS

    • Quantification based on extracted ion chromatograms

    • Structural confirmation of UndP-Ara4FN

These methods can be used to determine kinetic parameters (Km, Vmax, kcat) for both UDP-Ara4FN and undecaprenyl phosphate substrates, evaluate the effects of potential inhibitors, and study the dependence on divalent cations and pH.

What strategies can be employed to identify inhibitors of ArnC as potential antibiotic adjuvants?

Developing inhibitors of ArnC could sensitize resistant bacteria to polymyxins and other antimicrobials. A comprehensive inhibitor discovery campaign would include:

  • High-throughput screening:

    • Development of fluorescence-based or coupled enzymatic assays for ArnC activity

    • Screening of chemical libraries against purified ArnC

    • Counter-screening against mammalian glycosyltransferases to ensure selectivity

  • Structure-based design:

    • Use of cryo-EM structures for in silico docking of candidate compounds

    • Fragment-based approaches targeting the UDP-binding site

    • Design of substrate analogs that act as competitive inhibitors

  • Biochemical validation:

    • Determination of inhibition mechanisms (competitive, uncompetitive, or noncompetitive)

    • Measurement of binding constants using ITC, SPR, or microscale thermophoresis

    • Analysis of inhibitor effects on ArnC oligomerization and conformational changes

  • Cellular assessment:

    • Evaluation of inhibitor penetration into bacterial cells

    • Determination of polymyxin MICs in the presence of inhibitors

    • Assessment of synergy between inhibitors and various antimicrobial peptides

  • In vivo evaluation:

    • Pharmacokinetic and toxicity studies in animal models

    • Efficacy testing in infection models with resistant bacterial strains

    • Combination therapy studies with polymyxins or other antibiotics

How do mutations in the A-loop of ArnC affect substrate binding and catalysis?

The A-loop (residues 201-213) in ArnC undergoes significant conformational changes upon UDP binding, transitioning from a disordered to an ordered state . Mutations in this region would likely have profound effects on substrate binding and catalysis. To investigate these effects, a systematic mutagenesis approach can be employed:

Methodological Approach:

  • Site-directed mutagenesis of key A-loop residues, focusing on those that interact with UDP or contribute to loop stability

  • Expression and purification of mutant proteins using affinity chromatography

  • Kinetic characterization using radiometric or fluorescence-based assays to measure transfer of Ara4FN from UDP to undecaprenyl phosphate

  • Binding studies using isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) to determine changes in substrate affinity

  • Structural analysis of mutants using cryo-EM to visualize alterations in A-loop conformation

Expected Outcomes:
Mutations that disrupt the ability of the A-loop to adopt the closed conformation would likely decrease catalytic efficiency by preventing proper orientation of the UDP-Ara4FN substrate. Residues involved in direct interactions with UDP or the sugar moiety would show the most dramatic effects when mutated. Additionally, mutations that affect the dynamics of A-loop movement might alter the rate-limiting step of the reaction, potentially uncoupling substrate binding from catalysis.

How do structural differences in ArnC between different bacterial species affect inhibitor design strategies?

Structural variations in ArnC across different bacterial species present both challenges and opportunities for inhibitor design. To develop inhibitors with broad-spectrum activity or species-specific targeting:

Comparative Analysis Approach:

  • Sequence alignment and homology modeling:

    • Identification of conserved and variable regions in ArnC sequences from diverse pathogens

    • Construction of homology models for species where experimental structures are unavailable

  • Structural superposition and binding site analysis:

    • Comparison of experimentally determined structures (currently available for Salmonella typhimurium)

    • Mapping of binding site conservation across bacterial species

    • Identification of species-specific pockets or conformational features

  • Target selection strategy matrix:

Target RegionConservationPotential for Broad-Spectrum ActivitySpecies-Specific Targeting
UDP binding siteHighExcellentLimited
Ara4FN binding pocketModerateGoodPossible
Interface between protomersVariableLimitedExcellent
A-loopVariableModerateGood
Membrane interfaceVariableLimitedExcellent
  • Inhibitor design considerations:

    • Design of dual-targeting inhibitors that bind conserved catalytic residues and variable regions

    • Development of adaptable pharmacophores that can accommodate structural differences

    • Use of allosteric inhibitors that target species-specific conformational states

    • Design of prodrugs that are activated by species-specific enzymes

What is the relationship between ArnC activity and biofilm formation in pathogenic bacteria?

The relationship between ArnC-mediated lipid A modification and biofilm formation represents an emerging area of research with implications for bacterial persistence during infection. Investigation of this relationship would involve:

  • Comparative biofilm assays:

    • Analysis of biofilm formation in wild-type, arnC mutant, and complemented strains

    • Quantification using crystal violet staining, confocal microscopy, and biomass measurement

    • Evaluation of biofilm architecture and matrix composition

  • Gene expression studies:

    • Transcriptomic analysis to identify correlations between arnC expression and biofilm-related genes

    • Reporter gene assays to monitor arnC promoter activity during biofilm development

    • Single-cell studies to assess heterogeneity in arnC expression within biofilms

  • Phenotypic analysis:

    • Assessment of surface hydrophobicity in strains with varying ArnC activity

    • Measurement of cell-cell and cell-surface adhesion properties

    • Evaluation of biofilm resistance to antimicrobial treatments

  • In vivo biofilm models:

    • Use of animal infection models that support biofilm formation

    • Visualization of biofilms using specialized imaging techniques

    • Assessment of virulence and persistence of arnC mutants

This research could reveal new functions of ArnC beyond its established role in antimicrobial peptide resistance and potentially identify novel therapeutic strategies targeting both resistance and persistence mechanisms.

How do computational approaches contribute to understanding ArnC function and evolution?

Computational methods provide valuable insights into ArnC function and evolution that complement experimental approaches. Current computational strategies include:

  • Molecular dynamics simulations:

    • Investigation of ArnC dynamics in membrane environments

    • Analysis of conformational changes upon substrate binding

    • Prediction of water and ion pathways relevant to catalysis

  • Quantum mechanical calculations:

    • Elucidation of the detailed reaction mechanism

    • Calculation of energy barriers for key catalytic steps

    • Design of transition state analogs as potential inhibitors

  • Evolutionary analyses:

    • Phylogenetic studies to trace the evolution of arnC genes across bacterial species

    • Identification of selective pressures acting on different regions of the protein

    • Detection of co-evolution with other components of the lipid A modification pathway

  • Machine learning applications:

    • Prediction of ArnC activity based on sequence features

    • Virtual screening for novel inhibitors

    • Classification of bacterial strains based on potential for polymyxin resistance

These computational approaches can guide experimental design, suggest hypotheses for testing, and accelerate the development of strategies to combat antimicrobial resistance involving ArnC.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.