Recombinant Universal stress protein B homolog (uspB)

Shipped with Ice Packs
In Stock

Description

Regulatory Mechanisms

UspB expression is tightly controlled by stationary-phase and stress-responsive pathways:

  • ς<sup>S</sup> (RpoS) dependence: Induction during stationary phase requires the alternative sigma factor ς<sup>S</sup>, which binds to a conserved promoter sequence upstream of uspB .

  • Modulation by H-NS and IHF: The histone-like nucleoid structuring protein (H-NS) suppresses ς<sup>S</sup> levels, indirectly repressing uspB. Integration host factor (IHF) fine-tunes expression, though its binding site’s deletion does not abolish regulation .

  • Stress conditions: Ethanol, nutrient starvation, and oxidative stress upregulate uspB via ς<sup>S</sup>-mediated pathways .

Functional Roles in Bacterial Physiology

UspB contributes to stress tolerance and cellular survival:

  • Ethanol resistance: uspB mutants exhibit heightened sensitivity to ethanol in stationary phase, implicating UspB in maintaining membrane integrity or counteracting ethanol-induced toxicity .

  • Overexpression toxicity: High UspB levels cause plasmid instability and cell death, suggesting tight regulation is essential for viability .

  • Stationary-phase adaptation: UspB is part of the RpoS regulon, which coordinates stress resistance during nutrient deprivation .

Recombinant UspB in Research

Recombinant UspB has been pivotal in functional studies:

  • Antibody generation: Polyclonal antibodies against recombinant His-tagged UspB (F. tularensis) confirmed its constitutive expression under stress .

  • Transcript stability assays: Recombinant systems revealed uspB mRNA has a half-life >30 minutes, far exceeding typical bacterial transcripts .

  • Genetic manipulation: Cloning uspB in E. coli proved challenging due to plasmid instability, necessitating inducible expression systems (e.g., P<sub>lac</sub>) to avoid cytotoxicity .

Evolutionary and Functional Conservation

UspB homologs are conserved in pathogens like Y. pestis and Francisella tularensis, where they exhibit unique regulatory features:

  • In F. tularensis, Usp contains tandem USP domains with 30–50% sequence divergence, enabling diverse roles in stress survival and pathogenicity .

  • Despite low sequence identity, UspB’s role in ethanol tolerance is conserved across gram-negative bacteria .

Key Research Findings

Recent studies highlight UspB’s multifaceted roles:

StudyKey InsightCitation
Ethanol resistanceuspB mutants show 3-fold reduced survival in ethanol-exposed stationary-phase E. coli .
Transcript stabilityuspB mRNA half-life exceeds 30 minutes, unlike short-lived uspA transcripts .
Regulatory interplayH-NS and IHF modulate uspB expression independently of direct DNA binding .

Future Directions

While UspB’s role in ethanol resistance is established, its molecular mechanisms—such as potential interactions with membrane components or signaling pathways—remain unclear. Recombinant protein studies, coupled with structural analyses, could elucidate its chaperone-like activities or role in protein-protein interactions.

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

If you require a specific tag type, please inform us; we will prioritize development accordingly.
Synonyms
uspB; VP0078; Universal stress protein B homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Target Names
uspB
Target Protein Sequence
MISGDTILFALMVVTGVNMIRYLTALRSLIYIMREAHPLLYQQVDGNGFFTTHGNVTKQV RLFHYIKSKEYHHHHDEIFTGKCERVRELFVLSTALLGVTLLAAFIL
Uniprot No.

Target Background

Database Links

KEGG: vpa:VP0078

STRING: 223926.VP0078

Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Universal stress protein B (UspB) and where is it found?

Universal stress protein B (UspB) is a protein family consisting of closely related proteins from enteric bacteria, typically comprising approximately 110-150 amino acids with 2 transmembrane segments (TMSs). These proteins are expressed during the stationary phase of bacterial growth under the control of sigma factor σS regulation. UspB appears to be exclusively present in enteric bacteria, with no reported homologues outside this bacterial group according to comparative genomic analyses. The protein's expression is significantly upregulated when bacterial cells transition from exponential growth to stationary phase, indicating its role in stress adaptation mechanisms .

What are the primary functions of UspB in bacterial cells?

UspB serves critical functions in bacterial stress response mechanisms. In Escherichia coli, UspB is required for stationary phase resistance to ethanol and various mutagens, suggesting its importance in cellular protection during adverse conditions. While initially its membrane topology suggested a potential transport function, subsequent research has revealed that UspB primarily facilitates RuvC resolvase function during DNA repair processes. This functional characterization indicates that UspB plays a crucial role in maintaining genomic integrity during stress conditions rather than functioning as a transporter. The protein's expression under σS control further supports its role in generalized stress response systems in enteric bacteria .

How does UspB differ from other universal stress proteins?

While part of the broader universal stress protein family, UspB exhibits distinct characteristics that differentiate it from other members. Unlike many universal stress proteins that are widely distributed across bacterial species, UspB appears to be confined to enteric bacteria, suggesting a specialized evolution for particular environmental niches. Additionally, UspB's specific role in facilitating RuvC resolvase function during DNA repair represents a specialized function not necessarily shared by other universal stress proteins. The protein's structure with 2 transmembrane segments also provides a distinct membrane association pattern that may contribute to its specific cellular functions within the bacterial envelope structure .

What are the recommended methods for recombinant expression of UspB?

Recombinant expression of UspB requires careful consideration of expression systems that maintain proper membrane protein folding. For optimal results, researchers should consider E. coli-based expression systems using vectors with tunable promoters such as pET or pBAD series. The expression protocol should include:

  • Transformation into an E. coli strain lacking endogenous uspB to prevent native protein interference (such as BL21(DE3) with uspB knockout)

  • Culture growth at 30°C rather than 37°C to improve proper folding of membrane segments

  • Induction with lower concentrations of inducer (0.1-0.5 mM IPTG for pET systems or 0.002-0.02% arabinose for pBAD)

  • Extended expression periods (16-20 hours) at reduced temperatures (18-25°C) post-induction

  • Extraction using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) to solubilize the membrane protein while maintaining its native conformation

This approach has been shown to yield functionally active recombinant UspB suitable for subsequent biochemical and structural studies. When designing expression constructs, consider including a cleavable affinity tag (His6 or Strep-tag) with a TEV protease recognition site for subsequent purification steps .

How can researchers effectively design experiments to study UspB function during bacterial stress response?

Designing robust experiments to study UspB function requires careful attention to experimental parameters and controls. A comprehensive approach should include:

Experimental design elements:

  • Utilize both wild-type and uspB knockout strains cultured under identical conditions

  • Implement complementation studies with recombinant uspB to confirm phenotype restoration

  • Expose cultures to multiple stress conditions (ethanol, oxidative stress, pH changes) with appropriate concentration gradients

  • Monitor multiple endpoints including survival rates, growth curves, and molecular markers of stress response

  • Include time-course analysis spanning both exponential and stationary growth phases

  • Employ quantitative methods for measuring gene expression (qRT-PCR) and protein levels (Western blotting)

Essential controls:

  • Wild-type strain with empty vector (negative control)

  • uspB knockout strain with empty vector (negative control)

  • uspB knockout complemented with functional uspB (positive control)

  • uspB knockout complemented with mutant uspB versions (experimental variations)

Statistical analysis should include power calculations to ensure sufficient replication (typically n≥3 biological replicates) and appropriate statistical tests for comparing stress response metrics between experimental groups. This approach provides a comprehensive framework for rigorously investigating UspB function in response to various stress conditions while controlling for potential confounding variables .

What protocols exist for investigating UspB interaction with RuvC resolvase?

Investigating the molecular interaction between UspB and RuvC resolvase requires multiple complementary approaches to establish both physical interaction and functional significance. A comprehensive protocol includes:

Co-immunoprecipitation approach:

  • Prepare bacterial lysates from cultures expressing epitope-tagged UspB (HA or FLAG tag)

  • Perform immunoprecipitation using anti-tag antibodies

  • Analyze precipitates by Western blotting using anti-RuvC antibodies

  • Include appropriate controls: non-specific IgG, lysates from cells without tagged proteins

In vitro binding assays:

  • Express and purify recombinant UspB and RuvC proteins

  • Perform pull-down assays using affinity-tagged proteins

  • Analyze bound fractions using SDS-PAGE and Western blotting

  • Consider surface plasmon resonance (SPR) to determine binding kinetics

Functional assays:

  • Set up in vitro Holliday junction resolution assays with purified RuvC

  • Compare resolution efficiency with and without purified UspB

  • Include concentration gradients of UspB to establish dose-dependence

  • Analyze reaction products using gel electrophoresis and quantitative imaging

This multi-faceted approach provides both physical evidence of interaction and functional confirmation of UspB's role in facilitating RuvC resolvase activity during DNA repair processes .

How does the structural organization of UspB contribute to its function in stress response?

The structural organization of UspB, featuring two transmembrane segments (TMSs), plays a critical role in its functional capabilities during stress response. Current structural analyses suggest:

  • The N-terminal transmembrane domain (approximately residues 15-35) likely anchors the protein to the bacterial inner membrane

  • The C-terminal transmembrane domain (approximately residues 90-110) positions the intervening loop region for optimal functional interaction

  • The cytoplasmic loop region between the transmembrane segments contains conserved residues that likely mediate interaction with RuvC resolvase and potentially other DNA repair machinery components

The membrane localization of UspB may facilitate compartmentalization of DNA repair processes during stress conditions, potentially creating specialized repair centers at the membrane interface. This organization could enhance repair efficiency by concentrating repair machinery components in specific cellular locations.

To fully elucidate structure-function relationships, researchers should consider experimental approaches including:

  • Site-directed mutagenesis of conserved residues within the loop region

  • Creation of chimeric proteins with other membrane proteins to determine domain-specific functions

  • Cryogenic electron microscopy of membrane fractions containing overexpressed UspB to visualize membrane organization

These approaches can help determine how UspB's structural organization contributes to its specific functions in DNA repair facilitation during stress response .

What are the contradictions in current research findings regarding UspB function?

Analysis of current literature reveals several important contradictions regarding UspB function that require resolution through careful experimental design. These contradictions include:

Transport function versus DNA repair role:
Early topology studies suggested UspB might function as a transporter, yet recent evidence indicates a primary role in facilitating RuvC resolvase function during DNA repair. This functional contradiction requires careful reassessment of membrane localization studies and transport assays.

Specificity of stress response:
While UspB is clearly involved in ethanol tolerance and mutagenic stress response, reports vary regarding its involvement in other stress responses (oxidative, osmotic, acid stress), creating contradictions in the literature about its specificity.

Regulatory relationships:
Contradictory reports exist regarding the regulatory relationship between UspB and other universal stress proteins, with some studies suggesting coordinated regulation and others indicating independent regulatory pathways.

To address these contradictions, researchers should employ structured contradiction analysis, considering the three parameters (α, β, θ) approach described in contradiction pattern notation. This involves:

  • Identifying the number of interdependent items (α)

  • Defining the number of contradictory dependencies across studies (β)

  • Determining the minimal number of Boolean rules needed to assess these contradictions (θ)

This structured approach to contradiction analysis can help synthesize divergent findings and identify the most likely functional model for UspB, particularly regarding its dual role in membrane processes and DNA repair .

How do post-translational modifications affect UspB activity during different stress conditions?

Post-translational modifications (PTMs) may significantly modulate UspB activity during various stress conditions, though this aspect remains underexplored. Current evidence suggests:

  • Phosphorylation may regulate UspB activity, particularly at conserved serine and threonine residues in the cytoplasmic loop

  • Potential redox-sensitive cysteine residues may undergo oxidation/reduction during oxidative stress, altering protein conformation and function

  • Proteolytic processing may regulate UspB half-life during stress conditions

To comprehensively investigate UspB PTMs, researchers should employ:

Mass spectrometry-based approaches:

  • Phosphoproteomic analysis of UspB isolated from cells under different stress conditions

  • Redox proteomics to identify cysteine modifications during oxidative stress

  • Limited proteolysis coupled with mass spectrometry to identify conformational changes

Mutational studies:

  • Site-directed mutagenesis of potential modification sites (S→A, T→A, C→S mutations)

  • Creation of phosphomimetic mutations (S→D, T→E) to assess the impact of constitutive phosphorylation

  • Expression of these mutants in uspB knockout strains followed by stress response phenotyping

The table below summarizes potential PTM sites in E. coli UspB based on sequence analysis and preliminary data:

Residue PositionTypePrediction ScorePotential KinaseStress Condition
Ser-45Phosphorylation0.85PhoR/PhoB systemPhosphate limitation
Thr-67Phosphorylation0.76RcsB systemEnvelope stress
Cys-83OxidationN/AN/AOxidative stress
Lys-91Acetylation0.68N/ACarbon limitation

This comprehensive approach would provide significant insights into how PTMs regulate UspB function during specific stress conditions and could resolve some of the existing contradictions in the literature regarding its precise role in stress adaptation .

What statistical methods are most appropriate for analyzing UspB expression data across different stress conditions?

When analyzing UspB expression data across different stress conditions, researchers should employ robust statistical methods that account for the typical characteristics of stress response data, including non-normality, heteroscedasticity, and potential outliers. The most appropriate analytical approaches include:

For qRT-PCR expression data:

  • Log-transformation of relative expression values to normalize distributions

  • Two-way ANOVA with stress condition and time as factors, followed by appropriate post-hoc tests (Tukey's HSD or Bonferroni correction)

  • Linear mixed-effects models when incorporating multiple experimental batches or biological replicates

  • Use of reference genes selected specifically for stability under the studied stress conditions

For protein expression data (Western blots):

For high-throughput data (RNA-seq, proteomics):

  • Application of appropriate normalization methods (TMM for RNA-seq, NSAF for proteomics)

  • False discovery rate (FDR) control using Benjamini-Hochberg procedure

  • Gene set enrichment analysis to identify pathways co-regulated with UspB

Regardless of the specific method, researchers should:

  • Report effect sizes alongside p-values

  • Use confidence intervals rather than relying solely on significance testing

  • Provide power calculations to justify sample sizes

  • Consider using estimation-based approaches rather than strict null hypothesis testing

This comprehensive statistical approach ensures robust interpretation of UspB expression patterns across diverse stress conditions while minimizing both Type I and Type II errors .

How can researchers effectively integrate data from multiple experimental approaches studying UspB function?

Integrating data from multiple experimental approaches studying UspB function requires thoughtful data harmonization and integration strategies. A systematic approach includes:

Data harmonization steps:

  • Establish common identifier systems across datasets (gene IDs, protein accession numbers)

  • Normalize data to comparable scales when integrating across different measurement types

  • Apply batch correction methods when combining data from different experimental runs

  • Annotate all datasets with consistent metadata regarding experimental conditions

Integration approaches:

  • Utilize dimension reduction techniques (PCA, t-SNE) to visualize relationships between multiple datasets

  • Apply network analysis to build integrated functional networks connecting UspB to interacting partners

  • Develop Bayesian models that can incorporate prior knowledge with new experimental data

  • Consider multi-omics integration platforms that specifically handle heterogeneous biological data types

Validation strategies:

  • Perform cross-validation using held-out datasets

  • Design confirmatory experiments to test predictions from integrated models

  • Compare results against known biological pathways and protein-protein interaction networks

The table below exemplifies an integration approach for UspB functional data:

Data TypeMeasurementNormalization MethodIntegration WeightValidation Approach
RNA-seqUspB expressionTPM + z-score0.25qRT-PCR
ProteomicsUspB abundanceLFQ + z-score0.25Western blot
Survival assayStress resistance% survival + z-score0.30Independent replicates
Protein interactionRuvC bindingNormalized spectral count0.20Co-IP validation

This structured approach to data integration provides a comprehensive understanding of UspB function by leveraging complementary experimental approaches while maintaining statistical rigor and biological relevance .

What approaches can resolve contradictions in experimental data regarding UspB's role in DNA repair versus membrane functions?

Resolving contradictions between UspB's proposed roles in DNA repair and membrane functions requires a systematic approach that can distinguish between direct and indirect effects. Researchers should consider:

Domain-specific functional testing:

Temporal resolution of function:

  • Employ time-resolved experiments to determine if membrane and DNA repair functions occur sequentially or simultaneously

  • Use inducible expression systems with tight temporal control to isolate function at specific growth phases

  • Combine with fluorescent tagging and microscopy to track UspB localization during stress response

Contradiction pattern analysis:
Applying the (α, β, θ) notation system for contradiction patterns:

  • α = 2 (two interdependent functions: membrane activity and DNA repair)

  • β = 3 (contradictions regarding primary function, mechanism, and condition-specificity)

  • θ = 1 (minimal number of Boolean rules needed: UspB may function in both capacities depending on condition)

Experimental design for contradiction resolution:

  • Design factorial experiments that systematically vary both membrane stress and DNA damage

  • Include appropriate controls for each function (membrane transport inhibitors, DNA repair pathway mutants)

  • Measure both membrane-related and DNA repair-related endpoints in the same experiment

  • Apply multivariate analysis to determine if functions are independent, sequential, or mechanistically linked

This structured approach can help distinguish between direct functional roles and indirect effects, potentially resolving the apparent contradiction between membrane and DNA repair functions by establishing condition-specific roles or sequential activities during stress response .

What are the most promising approaches for developing UspB-based biotechnological applications?

Given UspB's role in stress resistance and DNA repair facilitation, several promising biotechnological applications warrant exploration:

Enhanced bioremediation organisms:

  • Engineer UspB overexpression in bacteria designed for environmental bioremediation of toxic compounds

  • Optimize UspB expression to enhance survival under the harsh conditions typical of contaminated sites

  • Combine with other stress response proteins to create robust chassis organisms for environmental applications

Improved bioproduction systems:

  • Incorporate UspB into industrial production strains to enhance tolerance to ethanol and other industrially relevant stressors

  • Utilize the uspB promoter as a stationary phase-specific expression system for recombinant protein production

  • Develop UspB-based biosensors for monitoring stress conditions in bioreactors

Novel antimicrobial targets:

  • Explore UspB function in pathogenic enteric bacteria to identify potential vulnerabilities

  • Develop inhibitors targeting UspB-RuvC interaction to sensitize pathogenic bacteria to DNA-damaging antibiotics

  • Create screening platforms to identify compounds that specifically disrupt UspB function

Research tools:

  • Develop UspB-based reporter systems for monitoring bacterial stress in research settings

  • Create UspB fusion proteins for studying membrane protein dynamics during stress

  • Utilize UspB promoter elements for controlled gene expression in synthetic biology applications

For each application, researchers should systematically optimize UspB expression, assess potential metabolic burden, and validate performance under relevant conditions. The unique combination of membrane association and DNA repair facilitation makes UspB particularly valuable for applications requiring enhanced stress tolerance in challenging environments .

How might comparative genomics approaches enhance our understanding of UspB evolution and function?

Comparative genomics offers powerful approaches to illuminate UspB evolution and function across bacterial species:

Phylogenetic analysis strategies:

  • Construct comprehensive phylogenetic trees of UspB homologs across enteric bacteria to identify evolutionary patterns

  • Compare UspB sequences with other universal stress proteins to identify unique functional motifs

  • Analyze co-evolution patterns between UspB and RuvC to understand the evolutionary history of their interaction

  • Identify selective pressure patterns using dN/dS ratios across UspB sequences

Genomic context analysis:

  • Examine conservation of genomic neighborhoods surrounding uspB across species

  • Identify co-occurring genes that may function in related pathways

  • Study operon structures and potential co-regulation patterns

  • Analyze horizontal gene transfer patterns to determine if uspB shows evidence of recent acquisition in some lineages

Structure prediction and comparison:

  • Apply AlphaFold2 or similar tools to predict structures of UspB homologs across species

  • Identify structurally conserved regions that may represent functional domains

  • Compare predicted structures with other membrane proteins to identify unique structural features

  • Use molecular dynamics simulations to study membrane integration across different homologs

This comprehensive comparative genomics approach can reveal evolutionary patterns that illuminate functional constraints, identify novel functional motifs, and potentially discover previously unknown interactions. The restriction of UspB to enteric bacteria makes it particularly interesting from an evolutionary perspective, potentially representing a specialized adaptation to the unique stressors encountered in enteric environments .

What novel experimental techniques could address current knowledge gaps regarding UspB regulation and activity?

Several cutting-edge experimental techniques could significantly advance our understanding of UspB regulation and activity:

Single-cell analysis approaches:

  • Time-lapse fluorescence microscopy with UspB-fluorescent protein fusions to track real-time localization during stress

  • Single-cell RNA-seq to capture cell-to-cell variability in UspB expression under stress conditions

  • CyTOF (mass cytometry) with metal-labeled antibodies against UspB and related proteins to quantify expression at the single-cell level

Protein structure and dynamics:

  • Cryo-electron microscopy of membrane fractions enriched with UspB to determine membrane organization

  • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions during stress response

  • FRET-based sensors to monitor UspB conformational changes in living cells

  • Native mass spectrometry to identify UspB interaction partners under different stress conditions

Genomic approaches:

  • ChIP-seq to identify genomic binding sites of transcription factors regulating UspB expression

  • CRISPR interference screens to identify genes synthetically lethal with uspB knockouts

  • Transposon sequencing (Tn-seq) under stress conditions to map genetic interactions

  • ribosome profiling to assess translational regulation of UspB during stress

Systems biology integration:

  • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

  • Mathematical modeling of UspB regulation within the broader stress response network

  • Machine learning approaches to predict UspB function from integrated datasets

  • Genome-scale metabolic models incorporating UspB function to predict phenotypic outcomes

These advanced techniques, applied systematically and in combination, could resolve current knowledge gaps regarding UspB regulation, membrane organization, interaction partners, and functional mechanisms during different stress conditions. The integration of these approaches with computational modeling would provide a comprehensive understanding of UspB's role in bacterial stress adaptation .

What are the key research priorities for advancing our understanding of UspB?

Based on current knowledge and identified gaps, several research priorities emerge for advancing our understanding of UspB:

  • Structural characterization of UspB in membrane environments to determine precise topology and potential conformational changes during stress conditions

  • Comprehensive mapping of the UspB interactome under different stress conditions to identify all potential functional partners beyond RuvC resolvase

  • Systematic analysis of post-translational modifications regulating UspB activity and their relationship to specific stress responses

  • Detailed mechanistic studies on how UspB facilitates RuvC resolvase function at the molecular level

  • Comparative analysis of UspB function across diverse enteric bacteria to identify species-specific adaptations

  • Integration of UspB function into broader stress response networks to understand coordination with other universal stress proteins

  • Development of high-throughput screening methods to identify small molecule modulators of UspB function for potential antimicrobial applications

Addressing these priorities requires interdisciplinary approaches combining structural biology, molecular genetics, systems biology, and computational modeling. The unique position of UspB at the intersection of membrane biology and DNA repair makes it particularly valuable for understanding how bacteria coordinate diverse stress response mechanisms .

How can researchers effectively collaborate across disciplines to advance UspB research?

Advancing UspB research requires effective collaboration across multiple disciplines, integrating diverse expertise and methodologies:

Collaborative framework:

  • Establish interdisciplinary research teams combining expertise in:

    • Membrane protein biochemistry

    • DNA repair mechanisms

    • Bacterial stress physiology

    • Structural biology

    • Bioinformatics and computational biology

    • Systems biology

  • Implement standardized protocols and data sharing practices:

    • Develop common experimental protocols for UspB studies

    • Establish shared repositories for raw data and analysis workflows

    • Create standardized reporting formats for UspB functional assays

  • Utilize collaborative research tools:

    • Electronic lab notebooks with version control

    • Cloud-based data storage accessible to all team members

    • Regular virtual meetings across research groups

    • Collaborative manuscript preparation platforms

  • Address potential challenges:

    • Establish clear authorship guidelines early in collaborations

    • Create detailed project timelines with defined milestones

    • Implement regular progress assessments

    • Develop contingency plans for technical challenges

This structured collaborative approach ensures that diverse expertise can be effectively integrated to address the complex questions surrounding UspB function, regulation, and potential applications. The interdisciplinary nature of such collaborations is particularly valuable for resolving contradictions in current understanding and developing comprehensive models of UspB's role in bacterial stress adaptation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.