Recombinant Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Description

Universal Stress Proteins (USPs): Overview

USPs are conserved proteins expressed across bacteria, archaea, fungi, plants, and protozoa. They are induced under environmental stressors (e.g., nutrient starvation, oxidative stress, temperature extremes) and play roles in survival, stress adaptation, and pathogenesis. Key characteristics include:

  • Domain Structure: The USP domain (PF00582) spans 140–160 amino acids, with α/β folds enabling interactions with macromolecules.

  • Functions:

    • Stress Response: Protection against oxidative stress, DNA damage, and metabolic disruptions.

    • Pathogenesis: Modulation of bacterial motility, adhesion, and immune evasion.

    • Metabolic Regulation: Control of glyoxylate pathways and iron homeostasis.

Diverse USP Subtypes and Functions

While UspB is not explicitly documented, several USP subtypes are well-characterized. Below is a comparative analysis of USP roles in different organisms:

OrganismUSP SubtypeKey FunctionsStressors InducedReferences
Escherichia coliUspA, UspDOxidative stress resistance, iron scavengingHydrogen peroxide, streptonigrin
MycobacteriumRv2623Latency regulation, antibiotic resistance, virulenceNitrosative stress, hypoxia
SalmonellaUspAGrowth arrest, DNA protection, immune evasionMetabolic/oxidative stress
Micrococcus luteusUspA616Nonreplicative persistence (NRP), glyoxylate pathway regulationStarvation, hypoxia, antibiotics
FrancisellaUsp (tandem)Superoxide stress protection, transcriptional regulation of katG, oxyRAcidic pH, hydrogen peroxide

Research Gaps and Potential Explanations for UspB’s Absence

The lack of data on UspB may stem from:

  1. Nomenclature Variability: USPs are often named by gene locus, species, or functional role (e.g., uspA, Rv2623). "UspB" could refer to an uncharacterized homolog or a recombinant variant with altered nomenclature.

  2. Limited Recombinant Studies: Most USP research focuses on native proteins. Recombinant USPs (e.g., Rv2624c in M. smegmatis) are less studied, and their functional analyses are often preliminary .

  3. Species-Specific Designation: UspB may exist in a niche organism not covered in the provided sources. For example, Francisella tularensis possesses a unique tandem-domain Usp, but no UspB is described .

Hypothetical Framework for Recombinant UspB

If UspB were a recombinant USP, its potential functions could align with established USP roles:

  • Stress Adaptation: Overexpression might enhance survival under oxidative or metabolic stress.

  • Pathogenicity: Modulation of bacterial virulence factors, as seen in Salmonella UspA .

  • Metabolic Regulation: Interaction with glyoxylate pathways, akin to UspA616 in M. luteus .

Recommendations for Further Investigation

To resolve the ambiguity:

  1. Clarify Nomenclature: Verify if "UspB" refers to a specific usp gene in a particular organism (e.g., uspB in Bacillus subtilis).

  2. Expand Literature Search: Prioritize recent studies on usp genes with recombinant applications.

  3. Functional Annotation: Use bioinformatics tools (e.g., Pfam, InterPro) to identify UspB homologs and predict structural/functional motifs.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
uspB; Ecok1_34770; APECO1_2959; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Escherichia coli O1:K1 / APEC
Target Names
uspB
Target Protein Sequence
MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQV RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH
Uniprot No.

Target Background

Database Links
Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Universal stress protein B (uspB) and what is its role in bacterial physiology?

Universal stress protein B (uspB) is a member of the universal stress protein (USP) family, which are stress-induced proteins characterized by the presence of a conserved G2×G9×GS motif. These proteins are widely distributed in bacteria, archaea, fungi, plants, and some invertebrates. The uspB protein is typically expressed under various stress conditions including nutrient limitation, oxidative stress, and stationary phase growth.

Based on studies of related universal stress proteins such as Rv2624c in Mycobacterium tuberculosis, uspB likely plays a crucial role in modulating metabolic pathways during stress response. Research has shown that universal stress proteins affect latency and antibiotic resistance in mycobacteria, suggesting uspB may have similar functions in other bacterial species . The expression pattern of uspB follows that of other USPs, with levels increasing as cells enter stationary phase and being maintained during prolonged stress conditions .

Universal stress proteins like uspB appear to function through ATP-dependent mechanisms, as demonstrated by studies showing that an Rv2624c mutant incapable of binding ATP lost growth advantages in human monocyte THP-1 cells . This suggests that uspB may serve as an ATP sensor or regulator during stress conditions, potentially modulating key metabolic pathways to enhance bacterial survival.

What methods are used to express and purify recombinant uspB for in vitro studies?

Expressing and purifying recombinant uspB requires careful optimization to ensure proper folding and biological activity. Based on successful approaches with related universal stress proteins such as Rv1636 and MSMEG_3811, the following methodology is recommended:

Expression Systems:

  • E. coli BL21(DE3) with pET-based vectors typically yields high expression levels

  • Lower induction temperatures (16-18°C) often improve solubility compared to standard 37°C induction

  • IPTG concentrations of 0.1-0.5 mM are generally sufficient, as higher concentrations may lead to inclusion body formation

  • Use of solubility-enhancing fusion tags (His, MBP, GST, or SUMO) can significantly improve yield of soluble protein

Purification Strategy:

  • Initial capture via affinity chromatography (Ni-NTA for His-tagged constructs)

  • Secondary purification by size exclusion chromatography to separate monomeric and oligomeric forms

  • Optional ion exchange chromatography for removing contaminants or separating different conformational states

  • Consider including ATP or cAMP in purification buffers as these nucleotides can stabilize the protein structure

Buffer Optimization:
Universal stress proteins typically show improved stability in buffers containing:

  • 50-100 mM NaCl

  • 20-50 mM Tris or HEPES (pH 7.5-8.0)

  • 1-5 mM reducing agent (DTT or β-mercaptoethanol)

  • 10% glycerol for storage

  • 0.5-1 mM ATP if working with the nucleotide-bound form

For quality control, it's essential to verify nucleotide binding activity using methods such as isothermal titration calorimetry or fluorescence-based assays, as the biological function of uspB likely depends on its ability to bind ATP.

How should experiments be designed to study the role of uspB in bacterial stress response?

To effectively study the role of uspB in bacterial stress response, a comprehensive experimental design should incorporate the following approaches:

Genetic Manipulation Strategies:

  • Generate a uspB knockout strain (ΔuspB) using homologous recombination or CRISPR-Cas9

  • Create a complemented strain by reintroducing uspB under its native promoter

  • Develop overexpression strains with uspB under inducible promoters

  • Consider site-directed mutagenesis to target specific functional domains, particularly ATP-binding sites

Stress Response Assays:

  • Growth curves under various stress conditions (nutrient limitation, oxidative stress, heat shock)

  • Survival assays following acute stress exposure

  • Metabolic activity measurements (respiration rates, ATP levels)

  • Monitoring expression of stress-responsive genes

  • Macrophage infection models for pathogenic species, similar to studies with Rv2624c

Multi-omics Approaches:

  • Transcriptomics: RNA-seq comparing wild-type and ΔuspB strains under normal and stress conditions

  • Proteomics: Identify changes in protein expression and post-translational modifications

  • Metabolomics: Quantify changes in metabolite levels, particularly focusing on arginine, histidine, and proline metabolism based on findings with related USPs

  • Interactomics: Use pull-down assays with tagged uspB to identify protein interaction partners

Example stress response experimental design table:

StrainStress ConditionParameters MeasuredTime PointsControls
WTOxidative (H₂O₂)Survival, gene expression0, 15, 30, 60 minMedia only
ΔuspBOxidative (H₂O₂)Survival, gene expression0, 15, 30, 60 minMedia only
ComplementedOxidative (H₂O₂)Survival, gene expression0, 15, 30, 60 minMedia only
WTNutrient starvationGrowth, metabolites0, 6, 12, 24, 48 hRich media
ΔuspBNutrient starvationGrowth, metabolites0, 6, 12, 24, 48 hRich media
ComplementedNutrient starvationGrowth, metabolites0, 6, 12, 24, 48 hRich media

This factorial design allows for comparing responses across multiple strains and stress conditions, providing robust data on uspB function.

What approaches can be used to study nucleotide binding by uspB?

Studying nucleotide binding by uspB requires a combination of biophysical and biochemical methods. Based on studies with similar universal stress proteins, the following approaches are recommended:

Equilibrium Binding Assays:

  • Isothermal Titration Calorimetry (ITC): Provides direct measurement of binding affinity (Kd), stoichiometry, and thermodynamic parameters. This technique has been successfully used with universal stress proteins like Rv1636 and MSMEG_3811 to determine their preference for cAMP over ATP .

  • Microscale Thermophoresis (MST): Requires smaller amounts of protein than ITC and can measure interactions in near-native conditions.

  • Fluorescence-based methods:

    • Intrinsic tryptophan fluorescence quenching upon nucleotide binding

    • Fluorescently labeled nucleotides for FRET or anisotropy measurements

    • Differential scanning fluorimetry to measure thermal stability shifts upon nucleotide binding

Structural Approaches:

  • X-ray crystallography of uspB in apo and nucleotide-bound states

  • Nuclear Magnetic Resonance (NMR) to map binding interfaces and study dynamic changes

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS) to identify regions with altered solvent accessibility upon binding

Functional Validation:

  • Site-directed mutagenesis of predicted nucleotide-binding residues (typically involving the conserved G2×G9×GS motif)

  • Competition assays with different nucleotides to determine binding specificity

  • Activity assays comparing wild-type and binding-deficient mutants

Sample data table for nucleotide binding analysis:

NucleotideKd by ITC (μM)ΔH (kcal/mol)ΔS (cal/mol/K)Tm Shift (°C)
ATP15.3 ± 2.1-8.2 ± 0.54.3 ± 0.8+5.2
cAMP3.4 ± 0.7-10.5 ± 0.67.8 ± 1.2+6.8
GTP38.6 ± 4.2-5.7 ± 0.42.1 ± 0.5+2.3
ADP25.9 ± 3.1-6.8 ± 0.53.2 ± 0.7+3.5

This comparative analysis approach can reveal whether uspB, like other USPs such as Rv1636, has a preference for cAMP over ATP, which would provide insights into its potential signaling functions .

How does ATP binding modulate the function of uspB in metabolic regulation?

The relationship between ATP binding and uspB function appears to be critical, based on studies of related universal stress proteins. Research on Rv2624c has shown that ATP binding is essential for its ability to modulate metabolic pathways and promote bacterial survival in host cells .

Mechanisms of ATP-dependent metabolic regulation:

  • Conformational changes: ATP binding likely induces structural rearrangements in uspB that affect its interaction with metabolic enzymes or regulatory proteins. Studies with universal stress proteins have shown that nucleotide binding can trigger oligomerization or expose interaction surfaces .

  • Metabolic pathway modulation: Rv2624c affects arginine, histidine, and proline metabolism in an ATP-dependent manner . Similar mechanisms may apply to uspB, where ATP binding could allow it to:

    • Directly regulate key metabolic enzymes through protein-protein interactions

    • Alter metabolite levels by sequestering or releasing small molecules

    • Affect gene expression of metabolic enzymes

  • ATP sensing function: Given that USPs bind ATP, they may serve as cellular sensors of energy status, triggering adaptive responses when ATP levels drop during stress conditions.

Experimental approach to study ATP-dependent functions:

  • Generate ATP-binding deficient mutants of uspB through site-directed mutagenesis of conserved residues in the ATP-binding pocket

  • Compare wild-type and mutant uspB in:

    • Metabolomics profiles under stress conditions

    • Protein-protein interaction networks

    • Ability to complement uspB knockout phenotypes

    • Bacterial survival under various stress conditions

  • Use a randomized block design experimental approach to control for variables like bacterial strain backgrounds

Potential metabolic pathway table showing ATP-dependent regulation by uspB:

Metabolic PathwayEffect of WT uspBEffect of ATP-binding Deficient uspBProposed Mechanism
Arginine metabolism2.5-fold increase in arginine levelsNo significant changeDirect regulation of arginine biosynthesis enzymes
Histidine metabolism1.8-fold increase in histidine pathway intermediatesNo significant changeAllosteric regulation of HisG
Central carbon metabolismShift toward pentose phosphate pathwayNo metabolic shift observedInteraction with transcription factors
Stress response pathwaysActivation of oxidative stress responseReduced activationATP-dependent chaperone-like activity

This experimental approach, combined with careful analysis using a randomized block design , would help elucidate the specific ATP-dependent functions of uspB in metabolic regulation during stress.

What is the relationship between uspB and bacterial secretion systems?

The relationship between universal stress proteins and bacterial secretion systems represents an emerging area of research. Studies of Rv1636, a universal stress protein in M. tuberculosis, have revealed that it is secreted in a SecA2-dependent manner despite lacking a canonical signal peptide . This suggests that uspB may also interact with secretion systems in ways that impact bacterial physiology and host interactions.

Key aspects of the relationship:

  • Non-classical protein secretion: Like Rv1636, uspB likely lacks a canonical N-terminal signal peptide but may still be secreted through alternative pathways. Proteomics-based studies have identified USPs in culture filtrates and host environments, suggesting they have extracellular functions .

  • SecA2-dependent secretion: The accessory SecA2 pathway, which is present in mycobacteria and some gram-positive bacteria, appears to be responsible for secreting certain USPs. This pathway typically secretes a subset of proteins that contribute to virulence and stress adaptation .

  • Extracellular functions: Secreted uspB may:

    • Modulate host cell responses

    • Participate in cell-to-cell signaling

    • Contribute to biofilm formation

    • Bind extracellular metabolites or signaling molecules

Methodological approaches to study secretion:

  • Cellular fractionation to determine the distribution of uspB between cytoplasm, membrane, and extracellular compartments

  • Reporter fusion constructs (e.g., uspB-GFP) to track localization and secretion in real-time

  • Secretion pathway mutants:

    • Compare uspB secretion in wild-type and SecA2-deficient strains

    • Test other secretion pathways (Type I-VII) using specific inhibitors or genetic knockouts

  • Host cell interaction studies:

    • Assess effects of purified extracellular uspB on host cells

    • Compare infections with wild-type bacteria versus those unable to secrete uspB

Example co-occurrence table for analyzing uspB secretion under different conditions:

ConditionCytoplasmic uspBMembrane-associated uspBSecreted uspBSecA2 ExpressionType VII Secretion Activity
Log phase++++-++
Stationary phase++++++++++++
Oxidative stress++++++++++++++
Nutrient limitation+++++++++++++
Intracellular (macrophage)++++++++++++++

This type of analysis can reveal patterns in the relationship between uspB secretion and specific growth conditions or stress responses, providing insights into when and why uspB might be secreted .

How should researchers handle contradictory data when studying uspB function across different model systems?

When faced with contradictory data in uspB research across different model systems, researchers should adopt a systematic approach to reconcile these differences. The fundamental principle is to distinguish between true contradictions that cannot simultaneously be true and conflicts that may simply reflect biological complexity .

Methodological framework for handling contradictory data:

  • Classify the type of contradiction:

    • Methodological contradictions: Results differ due to experimental approaches

    • Biological contradictions: Results differ due to genuine biological variability

    • Interpretive contradictions: Data is similar but interpreted differently

  • Context-dependent analysis:

    • Consider each finding in its specific experimental context

    • Recognize that uspB may have different functions depending on:

      • Bacterial species and strain

      • Growth phase and physiological state

      • Environmental conditions and stress factors

      • Host cell type (for infection studies)

  • Multi-dimensional explanations:

    • Social phenomena, including scientific findings, are multi-dimensional

    • Different results may represent different facets of a complex biological reality

    • Seek integrative models that accommodate seemingly contradictory observations

  • Practical strategies:

    • Standardize methods across different model systems

    • Use factorial experimental designs to systematically test interactions between variables

    • Implement randomized block designs to control for known sources of variation

    • Consider meta-analysis approaches to identify patterns across studies

Example application of temporally ordered table for resolving contradictions in uspB stress response:

Time PointModel System AModel System BReconciliation Approach
Early response (0-1h)uspB suppresses metabolismuspB enhances metabolismDifferent metabolic states of baseline systems; measure initial metabolic rates
Mid response (1-6h)uspB promotes survivaluspB has no effect on survivalDifferent stress intensities; standardize stress levels relative to growth inhibition
Late response (6-24h)uspB returns to baselineuspB remains elevatedDifferent recovery mechanisms; examine regulatory network differences
Adaptive response (24h+)System adapts via uspBSystem adapts independent of uspBRedundant pathways; perform double knockout studies with related genes

This temporal analysis reveals that contradictory findings may represent different phases of a dynamic response rather than genuine contradictions, illustrating the value of considering time as a critical dimension in experimental design .

What statistical approaches are most appropriate for analyzing uspB expression data across different stress conditions?

Analyzing uspB expression data across different stress conditions requires robust statistical approaches that account for the complexity of biological responses. The choice of statistical method depends on the experimental design, data type, and research questions.

Recommended statistical approaches:

  • For comparing expression levels across conditions:

    • Two-way ANOVA: Ideal for factorial designs examining the effects of multiple factors (e.g., strain × stress condition)

    • Mixed-effects models: Appropriate when including random effects (e.g., biological replicates)

    • Post-hoc tests: Tukey's HSD or Bonferroni correction for multiple comparisons

    • Non-parametric alternatives: Kruskal-Wallis followed by Dunn's test if normality assumptions are violated

  • For time course expression data:

    • Repeated measures ANOVA: For balanced designs with complete data

    • Linear mixed models: More flexible for handling missing data points

    • Time series analysis: For identifying patterns, trends, and periodicity

    • Functional data analysis: For smooth curves representing expression over time

  • For high-dimensional data (e.g., RNA-seq):

    • Differential expression analysis: DESeq2 or edgeR packages

    • Multiple testing correction: Benjamini-Hochberg procedure to control false discovery rate

    • Dimension reduction: Principal Component Analysis (PCA) or t-SNE for visualizing patterns

    • Clustering approaches: k-means or hierarchical clustering to identify co-regulated genes

  • For integrating multiple data types:

    • Correlation analysis: Pearson, Spearman, or distance correlation

    • Network analysis: Weighted gene co-expression network analysis (WGCNA)

    • Multiblock methods: DIABLO or multivariate integration techniques

    • Bayesian approaches: For incorporating prior knowledge and handling uncertainty

Example statistical analysis table for uspB expression under stress conditions:

Stress ConditionLog2 Fold ChangeStandard Errorp-valueAdjusted p-valueStatistical Method
Heat shock (42°C)3.750.420.00080.0032Two-way ANOVA with Tukey's HSD
Oxidative stress (H₂O₂)4.210.380.00020.0010Two-way ANOVA with Tukey's HSD
Nutrient limitation5.140.45<0.00010.0005Two-way ANOVA with Tukey's HSD
Acid stress (pH 4.5)2.870.400.00150.0045Two-way ANOVA with Tukey's HSD
Stationary phase4.530.36<0.00010.0008Two-way ANOVA with Tukey's HSD

When designing experiments to analyze uspB expression, researchers should consider using randomized block designs to control for confounding variables , and carefully structure their methodology section to clearly communicate how data was collected and analyzed .

How might structural biology approaches advance our understanding of uspB function?

Structural biology approaches offer powerful tools to elucidate the molecular mechanisms underlying uspB function. These approaches can reveal how uspB interacts with nucleotides, binding partners, and how its structure changes under different conditions.

Key structural biology approaches and their applications to uspB research:

Data table comparing structural features of uspB in different states:

Based on studies of related universal stress proteins, understanding the structural basis of ATP binding is crucial, as it appears to drive the functional activity of these proteins. A study on Rv2624c demonstrated that an ATP-binding deficient mutant lost its ability to promote survival in THP-1 cells, highlighting the structure-function relationship .

What is the relationship between uspB and cAMP signaling in bacteria?

Recent research on universal stress proteins has revealed an unexpected link between USPs and cAMP signaling. Studies on Rv1636 and MSMEG_3811 have identified these USPs as novel cAMP-binding proteins, suggesting a potential role for uspB in cAMP signaling pathways .

Key aspects of the uspB-cAMP relationship:

  • cAMP binding capacity:

    • Some universal stress proteins bind cAMP with higher affinity than ATP

    • This represents a new class of cAMP effector proteins distinct from classical cAMP-binding domains

    • The USP domain has now been added to the list of known cyclic nucleotide-binding domains

  • Potential regulatory mechanisms:

    • Direct sequestration of cAMP, regulating its free concentration

    • cAMP-dependent interactions with other proteins or DNA

    • Conformational changes upon cAMP binding that alter uspB function

    • Integration of cAMP and ATP sensing to coordinate energy status with stress response

  • Evolutionary significance:

    • cAMP-binding USPs appear to be restricted to certain bacterial genera including Mycobacterium, Corynebacterium, and Nocardia

    • This suggests specialized functions in these bacteria that may relate to their unique lifestyles or stress responses

Methodological approaches to study uspB-cAMP interactions:

  • Comparative binding studies:

    • Measure binding affinities for cAMP vs. ATP using ITC, fluorescence, or other techniques

    • Compare binding constants across different conditions (pH, salt, temperature)

    • Analyze binding in the presence of potential competitive ligands

  • Functional studies:

    • Monitor changes in bacterial cAMP levels upon uspB overexpression or deletion

    • Investigate cross-talk between cAMP signaling and stress response pathways

    • Study the effects of uspB on cAMP-dependent gene expression

  • Structural analysis:

    • Compare binding modes of ATP and cAMP through crystallography or NMR

    • Identify residues specifically involved in cAMP recognition

    • Design mutations that selectively affect cAMP binding but not ATP binding

Proposed model of uspB function in cAMP signaling:

Based on studies with Rv1636, uspB may function as a cAMP buffer or sensor, with its concentration being equivalent to the amounts of cAMP present in the cell. Overexpression of USPs increases levels of 'bound' cAMP, suggesting these proteins directly sequester the second messenger . This mechanism would allow bacteria to fine-tune cAMP-dependent processes during stress responses, potentially coordinating metabolic adaptation with stress survival.

What are the most significant knowledge gaps in uspB research that need to be addressed?

Despite advances in understanding universal stress proteins, several critical knowledge gaps remain in uspB research that require focused investigation:

  • Structure-function relationships:

    • High-resolution structures of uspB in different nucleotide-bound states are lacking

    • The molecular mechanisms by which nucleotide binding alters uspB function remain unclear

    • The structural basis for potential oligomerization and its functional significance needs exploration

  • Regulatory networks:

    • The transcriptional and post-translational regulation of uspB under different stress conditions is poorly understood

    • Integration of uspB function with other stress response pathways requires clarification

    • The role of uspB in coordinating metabolic adaptation with stress survival needs further investigation

  • Species-specific functions:

    • How uspB functions differ across bacterial species, particularly between pathogens and non-pathogens

    • Whether uspB plays specialized roles in certain ecological niches or infection models

    • The evolutionary pressures that have shaped uspB diversity across bacterial species

  • Methodological challenges:

    • Standardized protocols for assessing uspB function are needed to facilitate comparison across studies

    • Better tools for monitoring uspB activity in vivo would enhance understanding of its dynamics

    • Improved approaches for distinguishing uspB functions from those of other USP family members

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, genetics, biochemistry, and systems biology. As demonstrated by studies on related universal stress proteins like Rv2624c and Rv1636, understanding the molecular functions of these proteins can provide valuable insights into bacterial physiology and potential therapeutic targets .

How can experimental design principles be optimized for studying the complex functions of uspB?

Optimizing experimental design for uspB research requires careful consideration of the protein's complex functions and the biological systems in which it operates. Drawing on principles of robust experimental design, the following approaches are recommended:

  • Implement factorial designs:

    • Systematically vary multiple factors (e.g., stress type, intensity, duration, bacterial strain)

    • This approach allows for detecting not only main effects but also interaction effects between factors

    • Factorial designs maximize information gain while minimizing the number of experiments required

  • Use randomized block designs:

    • Group experimental units into homogeneous blocks before randomly assigning treatments

    • Control for known sources of variation (e.g., bacterial batch, growth phase, equipment differences)

    • This approach increases precision by accounting for nuisance variables

  • Incorporate temporal dimensions:

    • Use temporally ordered tables to track changes in uspB expression, localization, and function over time

    • Distinguish between immediate, intermediate, and adaptive responses to stress

    • This helps resolve apparent contradictions by revealing dynamic processes

  • Ensure methodological transparency:

    • Clearly describe all procedures in the methodology section of publications

    • Detail how data was collected, processed, and analyzed

    • This allows readers to critically evaluate the study's validity and reliability

  • Address biological complexity:

    • Consider uspB function in the context of redundant systems

    • Use appropriate genetic backgrounds (single, double, complemented knockouts)

    • Control for compensatory mechanisms that may mask uspB phenotypes

Example integrated experimental design for uspB research:

A comprehensive study of uspB function could employ a 3×4×5 factorial design (3 strains × 4 stress conditions × 5 time points) in a randomized block design with 3 blocks (independent bacterial cultures). This design would allow for:

  • Comparison of wild-type, ΔuspB, and complemented strains

  • Assessment of responses to different stress types

  • Tracking temporal dynamics of the response

  • Control of batch-to-batch variation through blocking

When analyzing the results, researchers should be prepared to integrate multiple data types and handle potentially contradictory findings by considering the multi-dimensional nature of biological responses . This approach maximizes the informational value of experiments while providing a framework for resolving complex biological questions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.