Recombinant UPF0041 protein F53F10.3 (F53F10.3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant UPF0041 Protein F53F10.3

Recombinant UPF0041 protein F53F10.3, also known simply as F53F10.3, is a protein encoded by the C. elegans gene F53F10.3, which is part of the UPF0041 family of proteins. This family is characterized by its involvement in various biological processes, including RNA metabolism and cellular stress responses. The recombinant version of this protein is produced through genetic engineering techniques, allowing for the study of its structure and function in a laboratory setting.

Functional Role

Research indicates that recombinant UPF0041 protein F53F10.3 plays a significant role in cellular processes such as:

  • RNA Surveillance: It is involved in the recognition and degradation of faulty mRNA molecules, thereby maintaining cellular RNA integrity.

  • Stress Response: The protein is believed to participate in cellular responses to environmental stresses, including oxidative stress.

Experimental Findings

Various studies have investigated the biological functions and potential applications of recombinant UPF0041 protein F53F10.3:

  • Gene Expression Studies: Experiments have shown that overexpression of F53F10.3 can enhance the degradation of specific mRNAs linked to stress responses.

  • Cell Culture Experiments: In vitro assays demonstrated that recombinant F53F10.3 can modulate cell survival under stress conditions, indicating its protective role.

Applications in Research and Medicine

The unique properties of recombinant UPF0041 protein F53F10.3 make it a valuable tool in various research fields:

  • Biotechnology: Its ability to modulate RNA metabolism can be harnessed for developing novel therapeutic strategies against diseases caused by RNA dysregulation.

  • Cancer Research: Given its role in stress responses, researchers are exploring its potential as a target for cancer therapies aimed at enhancing tumor cell sensitivity to treatment.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mpc-2; F53F10.3; Probable mitochondrial pyruvate carrier 2; MPC2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-133
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
mpc-2
Target Protein Sequence
MGPHRLLYQALCKAGDKFVYPVLPAFAKPAWNHAAGPKTVFFWAPTIKWTLIGAGLADLA RPADKLSLYQNSALFATGAIWTRYCLVITPINYYLSSVNFFVMCTGLAQLCRIAHYRYQN PDWETKEIMETHN
Uniprot No.

Target Background

Function

This protein may mediate the uptake of pyruvate into mitochondria.

Database Links
Protein Families
Mitochondrial pyruvate carrier (MPC) (TC 2.A.105) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0041 protein F53F10.3 and what organism does it originate from?

UPF0041 protein F53F10.3 is a protein from the nematode Caenorhabditis elegans, a widely used model organism in molecular biology research . The protein belongs to the UPF0041 family (Uncharacterized Protein Family 0041), which indicates its function has not been fully characterized. It consists of 133 amino acids and has a molecular weight of approximately 15,074 Da .

How is recombinant UPF0041 protein F53F10.3 typically tagged for purification purposes?

Recombinant UPF0041 protein F53F10.3 commonly contains an N-terminal tag and may also include a C-terminal tag depending on the expression construct . The specific tag types are determined by various factors including tag-protein stability considerations . When designing experiments using this protein, researchers should account for the potential influence of these tags on protein structure and function, especially for interaction studies or activity assays where the tag might interfere with native protein behavior.

What expression systems can be used for producing recombinant UPF0041 protein F53F10.3?

Recombinant UPF0041 protein F53F10.3 can be expressed in several host systems, each offering distinct advantages:

Host SystemAdvantagesRecommended Use Cases
E. coliHigher yields, shorter production timesStructural studies, antibody production
YeastGood yields, moderate post-translational modificationsGeneral purpose studies
Insect cells with baculovirusEnhanced post-translational modificationsStudies requiring proper protein folding
Mammalian cellsComprehensive post-translational modificationsFunctional studies requiring native activity

How do expression systems impact the post-translational modifications of UPF0041 protein F53F10.3?

The choice of expression system significantly impacts the post-translational modifications (PTMs) of UPF0041 protein F53F10.3, which may be crucial for its proper folding and function. While bacterial systems like E. coli offer high yield, they lack the cellular machinery for complex eukaryotic modifications . Insect cells with baculovirus expression systems can provide many of the post-translational modifications necessary for correct protein folding . Mammalian expression systems offer the most comprehensive PTM profile, potentially preserving the native activity of the protein as it would occur in C. elegans, though typically with lower yields compared to bacterial systems.

What purification methods are most effective for recombinant UPF0041 protein F53F10.3?

While specific purification protocols for UPF0041 protein F53F10.3 are not detailed in the available data, effective purification typically leverages the affinity tags incorporated in the recombinant protein design. Commercial preparations of this protein achieve ≥85% purity as determined by SDS-PAGE . Researchers working with this protein would typically employ a multi-step purification strategy:

  • Affinity chromatography using the N-terminal and/or C-terminal tags

  • Size-exclusion chromatography to remove aggregates and improve homogeneity

  • Additional polishing steps such as ion-exchange chromatography if higher purity is required

For experimental reproducibility, it's advisable to verify final purity through SDS-PAGE and potentially more sensitive analytical methods such as HPLC or mass spectrometry.

What are the optimal storage conditions for maintaining UPF0041 protein F53F10.3 stability?

For optimal stability of recombinant UPF0041 protein F53F10.3, the following storage conditions are recommended:

  • Short-term storage (working aliquots): 4°C for up to one week

  • Standard storage: -20°C in appropriate buffer (typically Tris-based with 50% glycerol)

  • Long-term storage: -80°C for extended preservation

It is critical to avoid repeated freeze-thaw cycles as these can lead to protein degradation, aggregation, and loss of activity . Preparing single-use aliquots during initial thawing is strongly recommended to preserve protein integrity across multiple experiments.

What buffer compositions are optimal for UPF0041 protein F53F10.3 stability?

Commercial preparations of UPF0041 protein F53F10.3 are typically stored in a Tris-based buffer containing 50% glycerol, optimized specifically for this protein . The high glycerol content serves as a cryoprotectant to prevent freeze damage during storage at -20°C or -80°C. When designing experiments, researchers should consider the potential impact of this storage buffer on their specific assay conditions and may need to perform buffer exchange if the glycerol concentration or buffer components interfere with planned applications.

How can UPF0041 protein F53F10.3 be applied in C. elegans research models?

UPF0041 protein F53F10.3 can be applied in C. elegans research across multiple experimental paradigms . While specific applications require further investigation due to the uncharacterized nature of this protein family, potential research applications include:

  • Protein-protein interaction studies to identify binding partners in C. elegans

  • Structural analysis to determine three-dimensional conformation

  • Generation of antibodies for immunolocalization studies

  • Functional reconstitution experiments to elucidate biochemical activities

  • Comparative studies with homologous proteins from other species

When designing such experiments, researchers should consider the potential effects of tags on protein function and the appropriate controls needed to account for these effects.

What analytical methods are appropriate for characterizing recombinant UPF0041 protein F53F10.3?

Several analytical methods can be employed to characterize recombinant UPF0041 protein F53F10.3:

  • SDS-PAGE: For purity assessment (commercial preparations achieve ≥85% purity)

  • Western blotting: For specific detection using antibodies against the protein or its tags

  • Mass spectrometry: For precise molecular weight determination and identification of post-translational modifications

  • Circular dichroism (CD) spectroscopy: For secondary structure analysis

  • Size-exclusion chromatography: For assessment of oligomeric state and homogeneity

  • Dynamic light scattering (DLS): For particle size distribution and potential aggregation analysis

These complementary techniques provide a comprehensive characterization of the recombinant protein's physicochemical properties, which is essential for ensuring experimental reproducibility.

What approaches can be used to investigate the cellular localization of UPF0041 protein F53F10.3 in C. elegans?

To determine the cellular localization of UPF0041 protein F53F10.3 in C. elegans, researchers can employ several complementary approaches:

  • GFP fusion protein expression: Creating a F53F10.3::GFP fusion construct and expressing it in C. elegans allows visualization of the protein's localization pattern in vivo . This approach requires careful design to ensure the fusion protein maintains native behavior.

  • Immunohistochemistry: Developing specific antibodies against UPF0041 protein F53F10.3 enables direct detection in fixed C. elegans specimens. This approach requires validation of antibody specificity.

  • Subcellular fractionation: Biochemical separation of cellular compartments followed by Western blot analysis can provide quantitative data on protein distribution across different cellular fractions.

  • CRISPR/Cas9-mediated tagging: Inserting fluorescent protein tags at the endogenous locus ensures physiological expression levels while enabling visualization.

Each method has distinct advantages and limitations, and combining multiple approaches provides the most reliable determination of cellular localization.

How can genetic approaches be used to investigate the function of UPF0041 protein F53F10.3?

Several genetic approaches can be employed to investigate the function of UPF0041 protein F53F10.3 in C. elegans:

  • CRISPR/Cas9 gene editing: Creating precise deletions, insertions, or point mutations in the F53F10.3 gene to observe resulting phenotypes .

  • RNAi-mediated knockdown: Using RNA interference to reduce expression levels and assess the resulting phenotypic consequences.

  • Transgenic rescue experiments: Reintroducing wild-type or mutant versions of F53F10.3 into mutant backgrounds to determine functional domains and critical residues.

  • Overexpression studies: Examining gain-of-function phenotypes by expressing F53F10.3 at higher-than-normal levels or in tissues where it is not typically expressed.

  • Genetic interaction studies: Combining F53F10.3 mutations with mutations in other genes to identify potential pathway components or functional relationships.

These genetic approaches provide powerful tools for dissecting the physiological roles of UPF0041 protein F53F10.3 in vivo.

What experimental design considerations are important when using recombinant UPF0041 protein F53F10.3 in interaction studies?

When designing interaction studies with recombinant UPF0041 protein F53F10.3, several key considerations should be addressed:

  • Tag interference: The presence of N-terminal or C-terminal tags may affect protein-protein interactions . Control experiments with different tag positions or tag-free protein should be considered.

  • Expression system selection: The choice of expression system affects post-translational modifications, which may be critical for certain protein-protein interactions . Comparing protein expressed in different systems can help identify PTM-dependent interactions.

  • Buffer conditions: Interaction studies should account for the storage buffer components, particularly the high glycerol content (50%) in commercial preparations . Buffer exchange may be necessary to optimize conditions for specific interaction assays.

  • Experimental controls: Appropriate positive and negative controls must be included to distinguish specific from non-specific interactions, particularly when using tagged proteins.

  • Technical approaches: Multiple complementary methods (pull-down assays, co-immunoprecipitation, yeast two-hybrid, surface plasmon resonance, etc.) should be employed to validate interactions from different perspectives.

These considerations help ensure that observed interactions reflect genuine biological phenomena rather than experimental artifacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.