Recombinant UPF0053 inner membrane protein ygdQ (ygdQ)

Shipped with Ice Packs
In Stock

Description

Synonyms and Nomenclature

The protein is known by several identifiers in scientific literature and commercial databases:

  • UPF0053 inner membrane protein ygdQ

  • YgdQ protein

  • Gene identifiers include Z4150 and ECs3689 in some E. coli strains

Predicted Protein Structure

The three-dimensional structure of ygdQ has been computationally modeled using AlphaFold, with the model designated as AF-P67127-F1 . This computational structure prediction provides significant insights into the protein's potential conformation despite the absence of experimentally determined structures through X-ray crystallography or NMR spectroscopy.

The AlphaFold model demonstrates a global pLDDT (predicted Local Distance Difference Test) score of 86.36, placing it in the "Confident" prediction range (70 < pLDDT ≤ 90) . This relatively high confidence score suggests that the predicted structural features are likely to represent the actual protein conformation with reasonable accuracy.

Membrane Topology

As an inner membrane protein, ygdQ's structure is characterized by transmembrane domains that anchor it within the bacterial cell membrane. Analysis of the protein sequence indicates multiple hydrophobic segments that likely form transmembrane helices, consistent with its classification as a transmembrane protein . This membrane topology is critical for understanding its potential functional roles within the bacterial cell.

Expression Systems

Recombinant ygdQ protein is typically produced using Escherichia coli expression systems . The protein can be expressed with various affinity tags to facilitate purification, with the most common being N-terminal His tags:

  • N-terminal 10xHis-tagged variants

  • His-tagged variants

These expression systems allow for the production of sufficient quantities of the protein for research and analysis purposes.

Known Functional Associations

Despite being classified as a protein of unknown function (as indicated by the UPF designation), some research has begun to elucidate potential roles of ygdQ:

The protein has been identified as a negatively regulated target of MgrR, a small RNA regulated by the PhoQ/P two-component system in E. coli . The PhoQ/P system responds to environmental conditions including low magnesium concentrations and the presence of antimicrobial peptides, suggesting that ygdQ may play a role in adaptations to these conditions .

Regulatory Mechanisms

The regulation of ygdQ by MgrR suggests integration into broader cellular response networks. The PhoQ/P system, which regulates MgrR, is known to control expression of various genes involved in:

  1. Magnesium transport

  2. Lipopolysaccharide (LPS) modifications

  3. Antimicrobial peptide resistance

This regulatory connection places ygdQ within pathways potentially related to membrane integrity and antimicrobial resistance mechanisms, though the precise functional contribution remains to be fully characterized.

Potential Role in Antimicrobial Responses

There is evidence suggesting a possible connection between ygdQ and responses to antimicrobial compounds. Research has identified that certain E. coli genes promote mitomycin C resistance, though the complete details regarding ygdQ's specific role in this process require further investigation .

Current Research Utilization

The recombinant ygdQ protein serves as a valuable tool for various research applications:

  1. Structural studies of bacterial membrane proteins

  2. Investigation of bacterial regulatory networks, particularly those involving small RNAs

  3. Analysis of bacterial responses to environmental stressors

  4. Exploration of novel antimicrobial resistance mechanisms

Knowledge Gaps and Research Opportunities

Several aspects of ygdQ remain poorly understood and represent promising areas for future research:

  1. Precise biological function and biochemical activities

  2. Interaction partners within the bacterial membrane

  3. Structural dynamics in different environmental conditions

  4. Potential as a target for novel antimicrobial compounds

  5. Evolutionary conservation and variation across bacterial species

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we will accommodate specific format requests. Please indicate your preferred format during order placement for tailored preparation.
Lead Time
Delivery time may vary based on your purchase method and location. Please consult your local distributors for precise delivery details.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is preferred, please communicate with us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C is advised. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us for preferential development.
Synonyms
ygdQ; c3427; UPF0053 inner membrane protein YgdQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-237
Protein Length
full length protein
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Target Names
ygdQ
Target Protein Sequence
MLFAWITDPNAWLALGTLTLLEIVLGIDNIIFLSLVVAKLPTAQRAHARRLGLAGAMVMR LALLASIAWVTRLTNPLFTIFSQEISARDLILLLGGLFLIWKASKEIHESIEGEEEGLKT RVSSFLGAIVQIMLLDIIFSLDSVITAVGLSDHLFIMMAAVVIAVGVMMFAARSIGDFVE RHPSVKMLALSFLILVGFTLILESFDIHVPKGYIYFAMFFSIAVESLNLIRNKKNPL
Uniprot No.

Target Background

Database Links

KEGG: ecc:c3427

STRING: 199310.c3427

Protein Families
UPF0053 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0053 inner membrane protein YgdQ and where is it found?

UPF0053 inner membrane protein YgdQ is a bacterial membrane protein primarily found in Escherichia coli. It belongs to the UPF0053 family of inner membrane proteins, which are generally uncharacterized protein families (as indicated by the UPF designation) . The protein is encoded by the ygdQ gene (also known by synonyms b2832 and JW2800 in E. coli) . YgdQ's localization to the inner membrane of bacterial cells suggests potential roles in membrane transport, signaling, or structural integrity, though specific functions remain to be fully elucidated through systematic research approaches.

What are the optimal storage conditions for recombinant YgdQ protein?

Recombinant YgdQ protein is typically supplied in liquid form containing glycerol . For short-term storage (up to one week), working aliquots can be maintained at 4°C . For extended storage, the protein should be kept at -20°C, or preferably at -80°C for maximum stability and activity preservation . It is critically important to avoid repeated freezing and thawing cycles as this can lead to protein denaturation and functional loss . Therefore, preparing small working aliquots upon initial thawing is recommended to minimize freeze-thaw cycles. The storage buffer typically contains glycerol as a cryoprotectant, which helps maintain protein stability during freeze-thaw transitions.

How can I verify the purity and integrity of recombinant YgdQ preparations?

Verification of recombinant YgdQ purity and integrity requires a multi-method approach. Begin with SDS-PAGE analysis to assess protein purity, with high-quality preparations typically showing >90% purity . Western blotting using antibodies specific to YgdQ or to tags incorporated into the recombinant construct (e.g., His-tag) can confirm protein identity. For membrane proteins like YgdQ, it's essential to evaluate proper folding, which can be assessed using circular dichroism spectroscopy to examine secondary structure elements. Additionally, size exclusion chromatography can determine whether the protein exists as a monomer or forms higher-order oligomers. When planning experiments with recombinant YgdQ, testing protein functionality through activity assays (if known) or binding studies is recommended to ensure that the purified protein maintains its native properties.

What are effective experimental designs for elucidating YgdQ function?

Elucidating the function of uncharacterized membrane proteins like YgdQ requires a systematic experimental design approach combining genomic, biochemical, and structural methods . Begin with bioinformatic analysis to identify conserved domains and predict potential functions based on homology. Design gene knockout experiments in E. coli using precise experimental controls as outlined in experimental design principles . When comparing wild-type and ygdQ deletion strains, implement the following experimental design elements:

  • Include both positive controls (known phenotypes) and negative controls (strains with deletions in unrelated genes)

  • Test multiple growth conditions systematically (varying carbon sources, pH, osmolarity, stress conditions)

  • Measure multiple output variables (growth rate, membrane integrity, specific metabolite levels)

  • Perform complementation studies with wild-type ygdQ to confirm phenotype specificity

For biochemical characterization, purify the recombinant protein and test for specific activities based on bioinformatic predictions. Protein-protein interaction studies using pull-down assays or crosslinking followed by mass spectrometry can identify functional partners. Throughout all experiments, maintain rigorous controls and statistical analysis as emphasized in proper experimental design methodology .

How should researchers approach structural studies of YgdQ protein?

Structural studies of membrane proteins like YgdQ present significant technical challenges that require specialized experimental approaches. When designing structural biology experiments for YgdQ, researchers should consider a multi-technique strategy:

  • Sample preparation optimization:

    • Screen multiple detergents systematically for extraction efficiency and protein stability

    • Consider alternative solubilization methods like nanodiscs or styrene-maleic acid copolymer lipid particles (SMALPs)

    • Assess protein homogeneity using analytical size exclusion chromatography

  • Structural technique selection based on experimental design principles :

    • X-ray crystallography: Requires extensive crystallization screening; lipidic cubic phase may be advantageous

    • Cryo-electron microscopy: Particularly useful if YgdQ forms higher-order assemblies

    • NMR spectroscopy: Consider solid-state NMR for membrane-embedded studies

Each structural approach requires specific controls and validation methods. For instance, when interpreting electron density maps, researchers should systematically test alternative models and validate refinement statistics. The experimental design should include multiple preparation methods and structural techniques to build confidence in the final structural model .

What strategies are recommended for analyzing contradictory data in YgdQ research?

When facing contradictory data in YgdQ research, a systematic experimental design approach is essential . First, thoroughly document all experimental variables that might contribute to discrepancies:

Variable CategorySpecific Factors to ConsiderDocumentation Method
Protein preparationExpression system, purification method, tagsDetailed protocols with batch tracking
Experimental conditionsTemperature, pH, buffer composition, detergentsSystematic variation with controls
Measurement techniquesDirect vs. indirect assays, sensitivity limitsMethod validation with standards
Biological contextGrowth phase, strain background, mediaStandardization across experiments

Next, design critical experiments specifically targeting the contradiction. Apply the experimental design principles of controlled variables, appropriate sample sizes, and statistical analysis . Consider that apparent contradictions may reveal:

  • Condition-dependent functions of YgdQ

  • Multiple functional roles of the protein

  • Technical artifacts specific to certain methodologies

When reporting contradictory findings, transparently present all data, discuss limitations, and propose models that might reconcile the contradictions. Remember that resolving such contradictions often leads to deeper understanding of protein function and highlights the importance of robust experimental design .

How should experiments be designed to study potential YgdQ interaction partners?

Designing experiments to identify and validate YgdQ interaction partners requires careful consideration of controls and potential artifacts intrinsic to membrane protein research . A comprehensive experimental design should include:

  • In vivo interaction identification:

    • Co-immunoprecipitation with epitope-tagged YgdQ

    • Crosslinking mass spectrometry to capture transient interactions

    • Split reporter systems adapted for membrane proteins

  • Control strategy implementation:

    • Negative controls: Parallel experiments with unrelated membrane proteins of similar abundance

    • Specificity controls: Competition with untagged protein

    • Technical controls: IgG-only pull-downs, pre-immune serum controls

  • Validation through multiple methods:

    • Reciprocal pull-downs with identified partners

    • Direct binding assays with purified components

    • Functional assays demonstrating biological relevance

  • Data analysis considerations:

    • Statistical filtering of mass spectrometry data

    • Enrichment analysis relative to controls

    • Network analysis to identify functional clusters

This experimental design approach minimizes false positives while maximizing discovery potential . When reporting interaction data, include quantitative measures of interaction strength and specificity, along with appropriate statistical analysis as emphasized in proper experimental design methodology .

What experimental design principles should guide YgdQ localization studies?

When designing experiments to determine YgdQ cellular localization and membrane topology, researchers should follow structured experimental design principles to ensure reliable results :

  • Technique selection with controls:

    • Fluorescent protein fusions: Include controls for both N- and C-terminal fusions

    • Subcellular fractionation: Include marker proteins for each fraction (cytoplasm, inner membrane, periplasm, outer membrane)

    • Protease accessibility assays: Use both membrane-permeable and impermeable proteases

  • Expression level considerations:

    • Use native promoter when possible to avoid overexpression artifacts

    • If using inducible promoters, titrate expression levels systematically

    • Include Western blot quantification to document expression levels

  • Topology mapping experimental design:

    • Cysteine accessibility scanning: Create a complete series of single-cysteine mutants

    • Reporter fusions: Use both PhoA (active in periplasm) and LacZ (active in cytoplasm) reporters

    • Compare results across multiple methods to build a consensus model

  • Data analysis framework:

    • Quantify signal distribution across cellular compartments

    • Apply appropriate statistical tests to localization data

    • Create topology models that integrate all experimental results

How can researchers overcome common challenges in recombinant YgdQ expression?

Membrane proteins like YgdQ often present significant expression challenges that require systematic troubleshooting based on experimental design principles . The following methodological approach addresses common issues:

  • Low expression levels:

    • Systematically test expression conditions by varying temperature (18°C, 25°C, 37°C)

    • Screen multiple E. coli expression strains specifically designed for membrane proteins (C41/C43, Lemo21)

    • Optimize codon usage for the expression host

    • Test different induction strategies (IPTG concentration, induction time)

  • Protein misfolding and aggregation:

    • Include molecular chaperones as co-expression partners

    • Reduce expression rate through lower inducer concentrations

    • Add membrane-stabilizing compounds to growth media

    • Test fusion partners that enhance membrane protein folding

  • Experimental design for optimization:

    • Use factorial design to efficiently test multiple variables

    • Implement quantitative readouts (fluorescence, activity assays)

    • Include appropriate controls at each step

    • Apply statistical analysis to optimization experiments

When documenting expression optimization, create detailed protocols that specify all variables and their systematic testing, consistent with proper experimental design methodology . This ensures that successful expression conditions can be reproduced reliably and adapted for different experimental needs.

What methodological approaches should be used to assess YgdQ purification quality?

Assessing the quality of purified YgdQ requires a multi-faceted approach rooted in sound experimental design principles :

Quality ParameterAssessment MethodAcceptance CriteriaControl Sample
PuritySDS-PAGE with densitometry>90% purityKnown concentration standards
IdentityMass spectrometryCoverage >80%, correct massIn silico digestion prediction
HomogeneitySize exclusion chromatographySingle symmetrical peakWell-characterized membrane protein
Structural integrityCircular dichroismSecondary structure content matches predictionDenatured protein control
Functional activityBinding/activity assaysConcentration-dependent responseKnown inactive mutant

The experimental design should include systematic assessment at each purification step to track improvements in quality parameters . Analytical methods should be calibrated with appropriate standards, and multiple methods should be used to cross-validate quality assessments. Statistical analysis of replicate preparations helps establish the reproducibility of the purification process . When reporting purification results, include quantitative measures for each quality parameter along with representative images of gels and chromatograms.

What statistical approaches are most appropriate for analyzing YgdQ functional data?

Selecting appropriate statistical methods for YgdQ functional studies requires careful consideration of experimental design principles . The following framework guides proper statistical analysis:

How should researchers integrate structural and functional data for comprehensive YgdQ characterization?

Integrating structural and functional data for YgdQ requires a systematic approach based on experimental design principles :

  • Structure-function correlation framework:

    • Map functional residues onto structural models

    • Design mutations based on structural features

    • Test functional consequences of mutations systematically

  • Experimental design for integrated analysis:

    • Test structure-based hypotheses with functional assays

    • Validate structural models with functional constraints

    • Use complementary techniques to address limitations of individual methods

  • Data integration strategies:

    • Create unified datasets combining structural parameters and functional measurements

    • Apply correlation analyses to identify structure-function relationships

    • Develop predictive models that integrate multiple data types

  • Visualization methods:

    • Generate structural representations highlighting functional regions

    • Create tables linking structural features to functional outcomes

    • Develop integrated figures showing both structural context and functional data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.