Recombinant UPF0053 inner membrane protein ytfL (ytfL)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

Recombinant UPF0053 inner membrane protein ytfL is a 447-amino acid polypeptide (UniProt IDs: P0AE46, P0AE47) expressed in E. coli systems . It belongs to the UPF0053 family and is annotated as a polyamine export protein (paeA) . The protein features a His-tag (typically N-terminal) for purification and detection .

Functional Role

ytfL facilitates polyamine transport across the inner membrane of E. coli, critical for maintaining cellular homeostasis . While its exact mechanism remains under investigation, homology studies suggest it operates via a proton gradient-dependent process .

Key Functional Insights:

  • Pathway Involvement: Linked to polyamine export, though specific pathways require further elucidation .

  • Interactions: Direct interactions with unidentified proteins/molecules detected via yeast two-hybrid and co-IP methods .

Expression Systems:

  • Host: E. coli (strains O6:H1, O157:H7) .

  • Vector: Optimized for high-yield in vitro expression .

Research Applications

  • Vaccine Development: Antigen candidate for E. coli pathogenicity studies .

  • Membrane Protein Studies: Used to characterize bacterial transporter topology .

  • Biochemical Assays: Purity and tag compatibility enable ELISA and affinity chromatography .

Limitations and Notes

  • Application Restrictions: For research use only; not approved for human/animal consumption .

  • Sequence Variability: Minor discrepancies in tags or termini exist between suppliers .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: Tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
paeA; ytfL; c5316; Polyamine export protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-447
Protein Length
full length protein
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Target Names
ytfL
Target Protein Sequence
MLNSILVILCLIAVSAFFSMSEISLAASRKIKLKLLADEGNINAQRVLNMQENPGMFFTV VQIGLNAVAILGGIVGDAAFSPAFHSLFSRYMSAELSEQLSFILSFSLVTGMFILFADLT PKRIGMIAPEAVALRIINPMRFCLYVCTPLVWFFNGLANIIFRIFKLPMVRKDDITSDDI YAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTPRENVIWFDLHEDEQSLKNKVAE HPHSKFLVCNEDIDHIIGYVDSKDLLNRVLANQSLALNSGVQIRNTLIVPDTLTLSEALE SFKTAGEDFAVIMNEYALVVGIITLNDVMTTLMGDLVGQGLEEQIVARDENSWLIDGGTP IDDVMRVLDIDEFPQSGNYETIGGFMMFMLRKIPKRTDSVKFAGYKFEVVDIDNYRIDQL LVTRIDSKATALSPKLPDAKDKEESVA
Uniprot No.

Target Background

Function

The recombinant UPF0053 inner membrane protein ytfL is involved in cadaverine and putrescine tolerance during stationary phase. It may facilitate the efflux of both cadaverine and putrescine from the cytoplasm, thereby mitigating potentially toxic intracellular levels under specific stress conditions.

Database Links

KEGG: ecc:c5316

STRING: 199310.c5316

Protein Families
UPF0053 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and cellular localization of ytfL protein?

ytfL is a UPF0053 inner membrane protein from Escherichia coli, consisting of 447 amino acid residues. As an inner membrane protein, ytfL is embedded within the cytoplasmic membrane of E. coli with specific transmembrane domains that anchor it within the lipid bilayer. The protein contains characteristic structural motifs common to the UPF0053 family, though detailed three-dimensional structural information remains limited in the current literature. Researchers investigating ytfL typically employ membrane fraction isolation techniques coupled with immunoblotting using anti-His antibodies (for recombinant His-tagged versions) to confirm its membrane localization and expression . For definitive structural characterization, techniques such as X-ray crystallography or cryo-electron microscopy would be necessary, with appropriate detergent solubilization to maintain protein stability during the purification process.

How can researchers effectively express recombinant ytfL protein in E. coli expression systems?

Expression of recombinant ytfL can be achieved through several E. coli expression systems, with BL21(DE3) being a common strain choice due to its protease deficiency. When designing expression protocols, researchers should consider the following methodological approach:

  • Vector selection: pET vectors containing T7 promoters provide tight control of expression

  • Fusion tag incorporation: His-tagging at either N-terminal or C-terminal facilitates purification

  • Induction conditions: Lower temperatures (16-25°C) and reduced IPTG concentrations (0.1-0.5mM) often increase proper membrane protein folding

  • Expression time: Extended expression periods (16-24 hours) at reduced temperatures

  • Membrane fraction isolation: Proper cell lysis followed by differential centrifugation

Commercially available recombinant ytfL proteins are typically expressed in E. coli with His-tags and encompass the full-length protein (1-447 amino acids) . For researchers preparing their own constructs, codon optimization may improve expression levels, particularly when working with rare codons that could limit translation efficiency in E. coli.

What experimental techniques are suitable for verifying the integrity of purified ytfL protein?

Verification of purified ytfL integrity requires multiple complementary techniques:

  • SDS-PAGE analysis: Confirms the expected molecular weight (~50 kDa including His-tag)

  • Western blotting: Using anti-His antibodies or custom ytfL antibodies

  • Mass spectrometry: For precise mass determination and sequence coverage

  • Circular dichroism (CD): Assesses secondary structure content and proper folding

  • Size-exclusion chromatography: Evaluates homogeneity and oligomeric state

  • Functional assays: Based on predicted biochemical activities

Researchers should be aware that membrane proteins like ytfL may exhibit anomalous migration on SDS-PAGE due to their hydrophobic nature. Additionally, proper refolding verification is crucial when extracting from inclusion bodies rather than membrane fractions. For functional verification, established assays specific to ytfL would be ideal, though they may need to be developed based on predicted functions from bioinformatic analyses if not already available in the literature.

How should researchers design experiments to study ytfL function using single-subject experimental design principles?

When investigating ytfL function using single-subject experimental design (SSED), researchers should implement a systematic approach that establishes clear baseline measurements before intervention. The experimental design should include:

  • Baseline phase: Collect at least 5 data points to establish stable pre-intervention measurements

  • Intervention phase: Introduce the experimental variable (e.g., ytfL knockout, overexpression, or mutation)

  • Multiple measurements: Assess dependent variables systematically over time

  • Replication: Include at least three replications of experimental effects

  • Control for threats to internal validity: Address potential confounding variables

Researchers should be vigilant for issues that could threaten experimental validity, including latency of effects after intervention, variability in baseline measurements, or trends unrelated to the intervention . When studying membrane proteins like ytfL, controlling for expression levels and ensuring proper localization through techniques such as fluorescent tagging can strengthen the experimental design. The SSED approach is particularly valuable when studying phenotypic changes associated with ytfL modifications in individual bacterial cultures or strains.

What controls and validation steps are necessary when studying protein-protein interactions involving ytfL?

When investigating protein-protein interactions involving ytfL, researchers should implement comprehensive controls and validation steps:

  • Input controls: Verify expression levels of both ytfL and putative interacting partners

  • Negative controls: Include unrelated membrane proteins of similar size/topology

  • Multiple methodologies: Combine at least two independent interaction detection methods:

    • Co-immunoprecipitation with tagged ytfL

    • Bacterial two-hybrid systems adapted for membrane proteins

    • FRET/BRET for in vivo interaction studies

    • Cross-linking followed by mass spectrometry

  • Reciprocal verification: Test interactions bidirectionally (pull-down with each protein as bait)

  • Domain mapping: Identify specific regions responsible for interactions

  • Functional validation: Demonstrate physiological relevance of interactions

Since ytfL is an inner membrane protein, researchers must employ techniques specifically designed for membrane-associated proteins, such as split-ubiquitin yeast two-hybrid systems or proximity-based labeling approaches (BioID, APEX). Detergent selection is critical during co-immunoprecipitation experiments to maintain native conformations while solubilizing membrane complexes. Validation across multiple experimental conditions strengthens confidence in identified interactions and helps establish biological significance within relevant pathways.

How can researchers effectively design knockout or knockdown studies to investigate ytfL function?

Designing effective knockout or knockdown studies for ytfL requires careful consideration of several methodological aspects:

  • Knockout strategy selection:

    • CRISPR-Cas9 system targeting the ytfL gene

    • Lambda Red recombination for precise gene deletion

    • Transposon mutagenesis for broader screening approaches

  • Validation requirements:

    • PCR verification of genetic modifications

    • RT-qPCR to confirm absence of transcript

    • Western blotting to confirm absence of protein

    • Complementation studies to verify phenotype specificity

  • Experimental controls:

    • Wild-type strain under identical conditions

    • Complemented knockout strain expressing ytfL

    • Knockout of unrelated genes to control for non-specific effects

  • Phenotypic analysis:

    • Growth curve analysis under various conditions

    • Membrane integrity assays

    • Stress response evaluations

    • Pathway-specific functional tests

When designing knockdown approaches using antisense RNA or CRISPRi, researchers should establish dose-dependent responses to confirm specificity and rule out off-target effects. Since ytfL is a membrane protein possibly involved in essential cellular processes, constructing conditional knockouts may be necessary if complete deletion proves lethal. Researchers should also consider potential compensatory mechanisms that might mask phenotypes in constitutive knockout systems.

What computational approaches can predict structure-function relationships for ytfL?

Computational prediction of ytfL structure-function relationships requires a multi-faceted approach:

  • Homology modeling: Using related proteins with known structures as templates

    • Identify suitable templates through sequence similarity searches

    • Apply specialized membrane protein modeling tools like MEMOIR or MEDELLER

    • Validate models through energy minimization and Ramachandran plot analysis

  • Ab initio modeling: When homology templates are insufficient

    • Apply Rosetta membrane protein modeling protocols

    • Incorporate evolutionary coupling information to constrain models

    • Validate through molecular dynamics simulations in membrane environments

  • Functional site prediction:

    • Identify conserved residues through multiple sequence alignments

    • Predict binding pockets using tools like CASTp or COACH

    • Analyze electrostatic surface potential for interaction interfaces

  • Molecular dynamics simulations:

    • Embed modeled structures in lipid bilayer simulations

    • Assess conformational stability and flexibility

    • Identify potential conformational changes related to function

Recent advances in de novo protein design methodologies can inform structure prediction approaches, particularly regarding the relationship between amino acid sequence and protein folding . Researchers should remain cognizant that computational predictions require experimental validation, using techniques such as site-directed mutagenesis of predicted functional residues followed by activity assays to confirm in silico findings.

How can researchers investigate ytfL involvement in cellular pathways and networks?

Investigating ytfL's involvement in cellular pathways requires integration of multiple experimental approaches:

  • Transcriptomic analysis:

    • RNA-seq comparing wild-type and ytfL mutant strains

    • Identify differentially expressed genes and enriched pathways

    • Conditional expression systems to detect immediate vs. secondary effects

  • Proteomics approaches:

    • Quantitative proteomics to identify altered protein levels

    • Phosphoproteomics to detect signaling pathway changes

    • Protein-protein interaction network mapping

  • Metabolomics integration:

    • Targeted metabolite analysis focused on pathways of interest

    • Untargeted metabolomics to identify unexpected metabolic changes

    • Flux analysis using labeled substrates

  • Systems biology integration:

    • Network analysis combining multiple data types

    • Pathway enrichment analysis using tools like KEGG or STRING

    • Mathematical modeling of affected pathways

Researchers should design experiments that capture both immediate responses to ytfL perturbation and adaptive changes that occur over longer timeframes. Time-course experiments are particularly valuable for distinguishing primary from secondary effects. Integration of multi-omics data can reveal emergent properties not evident from individual datasets, providing comprehensive insight into ytfL's functional role within cellular networks.

What are the methodological considerations for studying ytfL protein folding and stability?

Studying ytfL folding and stability presents unique challenges due to its membrane localization:

  • In vitro folding analysis:

    • Circular dichroism spectroscopy in detergent micelles or liposomes

    • Fluorescence spectroscopy monitoring intrinsic tryptophan emission

    • Differential scanning calorimetry to determine thermal stability

    • Hydrogen-deuterium exchange mass spectrometry to probe dynamics

  • In vivo folding assessment:

    • Protease susceptibility assays to probe membrane topology

    • Split GFP complementation to monitor folding efficiency

    • Cysteine accessibility methods to map transmembrane segments

  • Stability determinants investigation:

    • Systematic mutagenesis of conserved residues

    • Lipid composition effects on stability and function

    • Temperature and pH sensitivity profiling

  • Misfolding detection:

    • Aggregation monitoring through detergent-insoluble fractions

    • Interaction with membrane protein quality control machinery

    • Ubiquitination patterns indicating degradation targeting

Recent advances in understanding protein folding mechanisms from de novo protein design studies suggest that thermodynamics generally trumps kinetics in protein folding—if a sufficiently low free energy state exists, the protein will fold efficiently to reach that state . This principle may apply to ytfL as well, though membrane proteins often have more complex folding landscapes due to their heterogeneous environment. Researchers should consider the potential impact of the E. coli membrane composition on ytfL folding and stability, potentially reconstituting the protein in different lipid environments to assess functional and structural variations.

How can researchers overcome common challenges in membrane protein purification when working with ytfL?

Purification of membrane proteins like ytfL presents several technical challenges that can be addressed through methodical optimization:

  • Solubilization optimization:

    • Screen multiple detergents (DDM, LMNG, CHAPS) at various concentrations

    • Test detergent:protein ratios systematically

    • Consider native nanodiscs or amphipols for stabilization

    • Implement detergent exchange during purification steps

  • Expression enhancement:

    • Test multiple E. coli strains (C41, C43, Lemo21) specifically developed for membrane proteins

    • Optimize induction parameters (OD600, temperature, inducer concentration)

    • Consider fusion partners that enhance membrane insertion (Mistic, SUMO)

    • Evaluate cold-shock promoters for slow, controlled expression

  • Purification strategy refinement:

    • Implement two-step affinity chromatography followed by size exclusion

    • Include stabilizing additives (glycerol, specific lipids, ligands)

    • Monitor protein quality at each step via activity assays

    • Minimize exposure to air and maintain constant cold temperature

  • Aggregation prevention:

    • Include reducing agents to prevent disulfide-mediated aggregation

    • Optimize buffer composition (pH, ionic strength, specific ions)

    • Minimize freeze-thaw cycles and implement flash-freezing protocols

    • Consider on-column detergent exchange during purification

What strategies can address data variability in ytfL experimental studies?

Addressing data variability in ytfL studies requires systematic implementation of control measures:

  • Standardization practices:

    • Establish precise protocols for cell growth and protein expression

    • Standardize lysis and fractionation methods

    • Implement consistent purification parameters

    • Use internal controls for normalization between experiments

  • Technical approaches to reduce variability:

    • Increase biological and technical replication (minimum n=3 for both)

    • Implement randomization and blinding where appropriate

    • Use consistent data collection parameters across experiments

    • Establish clear inclusion/exclusion criteria for outlier handling

  • Statistical considerations:

    • Perform power analyses to determine adequate sample sizes

    • Apply appropriate statistical tests based on data distribution

    • Consider mixed-effects models to account for batch variability

    • Report effect sizes alongside p-values

  • Systematic error identification:

    • Maintain detailed records of environmental conditions

    • Track lot numbers of reagents and materials

    • Implement quality control checkpoints throughout protocols

    • Develop standard reference materials for inter-lab comparisons

When designing single-subject experimental studies for ytfL, researchers should establish stable baseline measurements with at least 5 data points per phase to ensure adequate experimental control . Overlap between baseline and intervention phases can obscure experimental effects, so researchers should strive to reduce variability through technical optimization. Additionally, changes in trend or variability patterns, not just mean differences, can provide evidence for experimental effects and should be carefully documented and analyzed.

How can researchers interpret contradictory data in ytfL functional studies?

When faced with contradictory data in ytfL studies, researchers should implement a systematic evaluation approach:

  • Technical contradiction assessment:

    • Evaluate methodological differences between studies

    • Assess sensitivity and specificity of different techniques

    • Consider detection limits and dynamic ranges of assays

    • Examine environmental variables (media composition, growth phase)

  • Biological context investigation:

    • Analyze strain-specific genetic backgrounds

    • Consider growth conditions affecting ytfL expression/function

    • Evaluate post-translational modifications not captured in all systems

    • Examine potential compensatory mechanisms in different models

  • Integrated reconciliation strategies:

    • Design experiments that directly test competing hypotheses

    • Implement orthogonal techniques to validate key findings

    • Perform time-course studies to capture dynamic processes

    • Consider condition-specific functions that may explain discrepancies

  • Systematic validation framework:

    • Reproduce key experiments using standardized protocols

    • Share materials between research groups

    • Establish collaborative validation studies

    • Consider protein-specific variables like conformation states

The robustness of experimental designs is critical for making valid causal inferences about ytfL function. When evaluating contradictory results, researchers should consider threats to internal validity such as latency in response to interventions or variability in baseline measurements . Additionally, as demonstrated in de novo protein design research, proteins may exhibit different folding and functional properties depending on their environment, suggesting that ytfL function may be context-dependent and explaining seemingly contradictory observations under different experimental conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.