Recombinant UPF0053 protein Mb2387c (Mb2387c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BQ2027_MB2387C; UPF0053 protein Mb2387c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-435
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB2387C
Target Protein Sequence
MTGYYQLLGSIVLIGLGGLFAAIDAAISTVSPARVDELVRDQRPGAGSLRKVMADRPRYV NLVVLLRTSCEITATALLVVFIRYHFSMVWGLYLAAGIMVLASFVVVGVGPRTLGRQNAY SISLATALPLRLISWLLMPISRLLVLLGNALTPGRGFRNGPFASEIELREVVDLAQQRGV VAADERRMIESVFELGDTPAREVMVPRTEMIWIESDKTAGQAMTLAVRSGHSRIPVIGEN VDDIVGVVYLKDLVEQTFCSTNGGRETTVARVMRPAVFVPDSKPLDALLREMQRDRNHMA LLVDEYGAIAGLVSIEDVLEEIVGEIADEYDQAETAPVEDLGDKRFRVSARLPIEDVGEL YGVEFDDDLDVDTVGGLLALELGRVPLPGAEVISHGLRLHAEGGTDHRGRVRIGTVLLSP AEPDGADDEEADHPG
Uniprot No.

Target Background

Protein Families
UPF0053 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0053 protein Mb2387c and what organism does it originate from?

UPF0053 protein Mb2387c is a 435 amino acid transmembrane protein from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97). It belongs to the UPF0053 family, where "UPF" denotes "Uncharacterized Protein Family," indicating its function remains to be fully elucidated. The protein is encoded by the gene BQ2027_MB2387C and has the UniProt ID P67131 .

What expression systems are suitable for producing recombinant UPF0053 protein Mb2387c?

Multiple expression systems have been successfully employed for producing recombinant UPF0053 protein Mb2387c, including:

Expression SystemAdvantagesConsiderations
E. coliMost commonly used, high yield potential, cost-effectiveMay form inclusion bodies requiring refolding
YeastPost-translational modifications, membrane protein capacityLonger expression time, complex media requirements
BaculovirusEfficient for complex proteins, higher-order foldingMore expensive, technically demanding
Mammalian cellsMost native-like processing, complex protein assemblyHighest cost, longest production time
Cell-free systemsRapid expression, direct incorporation of non-natural amino acidsLimited scale, potentially lower yields

The most documented system is E. coli, where the protein is typically expressed with an N-terminal His tag to facilitate purification .

What are methodologically sound approaches for purifying recombinant UPF0053 protein Mb2387c?

A systematic purification strategy for recombinant UPF0053 protein Mb2387c should include:

  • Cell lysis optimization:

    • Mechanical disruption (sonication, high-pressure homogenization)

    • Enzymatic lysis with lysozyme for E. coli systems

    • Buffer supplementation with protease inhibitors

  • Membrane protein solubilization:

    • Screening mild detergents (n-dodecyl-β-D-maltoside, CHAPS, digitonin)

    • Determining optimal detergent concentration through small-scale trials

    • Maintaining protein stability with glycerol and salt additives

  • Chromatographic purification:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged protein

    • Ion exchange chromatography as an orthogonal step

    • Size exclusion chromatography as a final polishing step

Using these approaches, purities greater than 90% as determined by SDS-PAGE can be achieved for recombinant UPF0053 protein Mb2387c .

How can stability of purified UPF0053 protein Mb2387c be maintained during storage?

Optimizing storage conditions is critical for maintaining UPF0053 protein Mb2387c stability:

  • Short-term storage (1 week):

    • Store working aliquots at 4°C

    • Maintain protein in buffer with stabilizing detergent above CMC

  • Long-term storage:

    • Store at -20°C/-80°C in buffer containing 50% glycerol

    • For lyophilized protein, store at -20°C/-80°C and reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol and prepare small aliquots to avoid freeze-thaw cycles

  • Recommended storage buffer:

    • Tris/PBS-based buffer with 6% trehalose, pH 8.0

    • Trehalose acts as a cryoprotectant, stabilizing protein during freeze-thaw cycles

Repeated freeze-thaw cycles should be strictly avoided as they significantly compromise protein stability and functionality .

What experimental strategies can elucidate the function of UPF0053 protein Mb2387c?

Given the uncharacterized nature of UPF0053 protein Mb2387c, a multi-faceted approach is recommended:

  • Bioinformatic analysis:

    • Phylogenetic profiling across mycobacterial species

    • Structural modeling and comparison with characterized proteins

    • Genomic context analysis to identify functionally related genes

  • Biochemical characterization:

    • Lipid binding assays (particularly relevant for membrane proteins)

    • Transport assays if membrane transport function is suspected

    • Enzymatic activity screens using substrate libraries

  • Genetic approaches:

    • Gene knockout or knockdown using CRISPR-Cas9 or antisense RNA

    • Complementation studies in knockout strains

    • Conditional expression systems to study essential genes

  • Protein interaction studies:

    • Pull-down assays using tagged recombinant protein

    • Proximity labeling methods (BioID, APEX)

    • Membrane protein crosslinking to capture transient interactions

  • Localization studies:

    • Subcellular fractionation combined with western blotting

    • Immunoelectron microscopy for precise localization

    • Fluorescent protein fusion imaging if compatible with function

These approaches should be applied iteratively, with each result informing subsequent experimental design to gradually build a functional profile .

How does UPF0053 protein Mb2387c potentially relate to Mycobacterium bovis pathogenicity?

While direct evidence linking UPF0053 protein Mb2387c to pathogenicity is not explicitly documented in current research, several methodological approaches can investigate this relationship:

  • Comparative genomics:

    • Analyze conservation across pathogenic versus non-pathogenic mycobacteria

    • Examine genetic polymorphisms in clinical isolates with varying virulence

  • Host-pathogen interaction studies:

    • Assess protein expression during infection using transcriptomics/proteomics

    • Determine if the protein interfaces with host immune components

    • Evaluate contribution to antibiotic resistance mechanisms

  • Virulence assessment:

    • Create knockout mutants and evaluate survival in macrophage models

    • Assess impact on biofilm formation and persistence

    • Measure virulence parameters in animal infection models

  • Structural considerations:

    • Identify structural features that might contribute to pathogen survival

    • Assess potential as drug target based on essentiality and structural uniqueness

Understanding this protein's role could potentially contribute to therapeutic developments against mycobacterial infections if it proves to be involved in pathogenicity mechanisms .

What structural biology approaches are appropriate for analyzing UPF0053 protein Mb2387c?

As a membrane protein, UPF0053 protein Mb2387c presents unique challenges for structural analysis. A comprehensive strategy would include:

Integrating data from multiple approaches would provide the most comprehensive structural model of this challenging membrane protein .

What are the optimal methods for studying protein-protein interactions involving UPF0053 protein Mb2387c?

Investigating protein-protein interactions for membrane proteins requires specialized approaches:

  • Affinity-based methods:

    • Tandem affinity purification with gentle detergent solubilization

    • Co-immunoprecipitation with antibodies against UPF0053 protein Mb2387c

    • Pull-down assays using recombinant tagged protein as bait

  • Proximity-based approaches:

    • BioID or TurboID proximity labeling in native cellular environment

    • APEX2-mediated proximity labeling for temporal resolution

    • Photo-crosslinking with unnatural amino acids at predicted interfaces

  • Biophysical techniques:

    • Microscale thermophoresis for quantitative binding parameters

    • Surface plasmon resonance with captured protein in lipid environment

    • Förster resonance energy transfer for in vivo interaction analysis

  • Systems-level analysis:

    • Quantitative proteomics comparing wild-type vs. knockout strains

    • Protein correlation profiling across fractionation gradients

    • Network analysis integrating multiple interaction datasets

  • Validation strategies:

    • Bacterial two-hybrid systems for confirming direct interactions

    • Mutagenesis of predicted interaction interfaces

    • Co-expression studies to assess functional relationships

These methods should be applied with appropriate controls to distinguish specific from non-specific interactions, a particular challenge with hydrophobic membrane proteins .

How can UPF0053 protein Mb2387c research inform drug discovery efforts against mycobacterial infections?

Investigating UPF0053 protein Mb2387c can potentially contribute to antimycobacterial drug discovery through several methodological pathways:

  • Target validation approach:

    • Essentiality assessment through conditional knockdown systems

    • Growth defect quantification in various environmental conditions

    • Demonstration of attenuated virulence in infection models

  • Structure-based drug design:

    • Identification of druggable pockets through structural analysis

    • Virtual screening campaigns against resolved structures

    • Fragment-based approaches to identify initial chemical matter

  • High-throughput screening:

    • Development of functional assays suitable for compound screening

    • Phenotypic screens against genetically modified reporter strains

    • Whole-cell activity assays followed by target deconvolution

  • Resistance mechanism investigation:

    • Analysis of UPF0053 protein Mb2387c mutations in resistant isolates

    • Evaluation of efflux pump interaction possibilities

    • Assessment of cell envelope permeability effects

  • Comparative analysis:

    • Identification of structural differences from human homologs

    • Exploration of mycobacteria-specific features for selectivity

    • Cross-species conservation analysis for broad-spectrum potential

This systematic approach could determine whether UPF0053 protein Mb2387c represents a viable target for novel antimycobacterial therapeutics, particularly important given the rising challenge of drug-resistant tuberculosis .

What omics approaches provide complementary insights into UPF0053 protein Mb2387c function?

A comprehensive omics strategy can effectively characterize UPF0053 protein Mb2387c function:

  • Transcriptomics methodologies:

    • RNA-seq comparing expression in different growth conditions

    • Identification of co-regulated genes through correlation networks

    • Analysis of expression changes in response to stressors

  • Proteomics strategies:

    • Quantitative proteomics in knockout vs. wild-type strains

    • Secretome analysis to detect potential exported interactors

    • Post-translational modification mapping

  • Metabolomics approaches:

    • Untargeted metabolomics to identify affected pathways

    • Flux analysis using stable isotope labeling

    • Lipidomics with focus on membrane composition changes

  • Systems biology integration:

    • Multi-omics data integration through pathway analysis

    • Network construction linking protein to cellular processes

    • Machine learning to predict functional relationships

  • Comparative omics:

    • Cross-species analysis in related mycobacteria

    • Temporal profiling during infection process

    • Analysis across drug treatment conditions

This multi-layered approach can position UPF0053 protein Mb2387c within the broader context of mycobacterial physiology and potentially reveal its function through the cellular processes it influences .

What are common difficulties in working with recombinant UPF0053 protein Mb2387c and how can they be addressed?

Working with transmembrane proteins like UPF0053 protein Mb2387c presents several technical challenges:

  • Expression issues:

    • Low yield: Optimize by reducing induction temperature (16-20°C) and using specialized strains (C41/C43)

    • Toxicity: Employ tight regulation systems and secretion pathways

    • Inclusion bodies: Co-express chaperones and evaluate fusion partners (MBP, SUMO)

  • Solubilization challenges:

    • Inefficient extraction: Screen detergent panel (DDM, LMNG, GDN) at varying concentrations

    • Detergent incompatibility: Test detergent exchanges during purification

    • Protein aggregation: Include stabilizing additives like glycerol or specific lipids

  • Purification complications:

    • Contaminant co-purification: Implement additional orthogonal chromatography steps

    • Tag accessibility: Consider internal or C-terminal tags if N-terminal is embedded

    • Non-specific binding: Optimize imidazole concentration gradients for IMAC

  • Stability problems:

    • Rapid degradation: Add protease inhibitors and minimize purification time

    • Precipitation during concentration: Use spin concentrators with appropriate MWCO and gentle centrifugation

    • Activity loss: Maintain critical lipids or cofactors throughout purification

  • Functional analysis complications:

    • Lack of positive controls: Benchmark against related characterized proteins

    • Assay development: Implement multiple parallel approaches to detect activity

    • Reconstitution issues: Optimize proteoliposome preparation conditions

Implementing these troubleshooting strategies can significantly improve the success rate when working with this challenging membrane protein .

How can researchers validate proper folding and functionality of recombinant UPF0053 protein Mb2387c?

Ensuring proper folding of recombinant UPF0053 protein Mb2387c is critical for functional studies. A methodical validation approach includes:

This comprehensive validation strategy ensures that functional studies are performed with properly folded protein, increasing confidence in subsequent mechanistic interpretations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.