Recombinant UPF0053 protein Rv1842c/MT1890 (Rv1842c, MT1890)

What is UPF0053 protein Rv1842c/MT1890?

UPF0053 protein Rv1842c/MT1890 is a full-length protein (455 amino acids) encoded by the Rv1842c gene in Mycobacterium tuberculosis. The protein belongs to the UPF0053 family, which contains proteins of unknown function. The full amino acid sequence is: MNLTDTVATILAILALTAGTGVFVAAEFSLTALDRSTVEANARGGTSRDRFIQRAHHRLS FQLSGAQLGISITTLATGYLTEPLVAELPHPGLVAVGMSDRVADGLITFFALVIVTSLSM VFGELVPKYLAVARPLRTARSVVAGQVLFSLLLTPAIRLTNGAANWIVRRLGIEPAEELR SARTPQELVSLVRSSARSGALDDATAWLMRRSLQFGALTAEELMTPRSKIVALQTDDTIA DLVAAAAASGFSRFPVVEGDLDATVGIVHVKQVFEVPPGDRAHTLLTTVAEPVAVVPSTL DGDAVMAQVRASALQTAMVVDEYGGTAGMVTLEDLIEEIVGDVRDEHDDATPDVVAAGNG WRVSGLLRIDEVASATGYRAPDGPYETIGGLVLRELGHIPVAGETVELTALDQDGLPDDS MRWLATVIQMDGRRIDLLELIKMGGHADPGSGRGR .

This protein has been successfully expressed in E. coli expression systems with an N-terminal His tag to facilitate purification. While its precise function remains under investigation, structural analysis and comparative genomics suggest it may play a role in cell membrane processes based on its sequence characteristics.

How is recombinant Rv1842c/MT1890 typically expressed and purified?

Recombinant Rv1842c/MT1890 is typically expressed in E. coli expression systems. The methodology involves:

• Cloning the full-length coding sequence (1-455aa) into an appropriate expression vector

• Adding an N-terminal His tag to facilitate purification

• Transforming the construct into a suitable E. coli strain

• Inducing expression with IPTG under optimized conditions

• Lysing cells and purifying the protein using affinity chromatography

For optimal expression, the culture media composition significantly impacts protein yield and solubility. Media screening techniques can identify the most suitable formulation for this specific protein . After purification, the protein is typically obtained as a lyophilized powder that requires proper reconstitution in a suitable buffer system for experimental use .

What are the optimal storage conditions for recombinant Rv1842c/MT1890?

For maximum stability and activity retention of recombinant Rv1842c/MT1890:

• Store the lyophilized powder at -20°C/-80°C upon receipt

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (50% is recommended)

• Prepare working aliquots to avoid repeated freeze-thaw cycles

• Store working aliquots at 4°C for up to one week

• For long-term storage, keep aliquots at -20°C/-80°C

It is crucial to centrifuge the vial briefly before opening to bring contents to the bottom. The reconstituted protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain structural integrity and prevents aggregation .

How can I optimize expression conditions for recombinant Rv1842c/MT1890?

Optimizing expression conditions requires systematic evaluation of multiple parameters:

Media Selection:

Different media formulations significantly impact recombinant protein yield and solubility. A screening approach using multiple media types is recommended:

Test all media types with small-scale cultures (2 mL) in parallel, inducing expression at equivalent cell densities (OD600 ≈ 0.6) with 1 mM IPTG, followed by SDS-PAGE analysis to determine relative protein accumulation .

Additional Optimization Parameters:

• Induction timing (early, mid, or late exponential phase)

• IPTG concentration (0.1-1.0 mM range)

• Post-induction temperature (16°C, 25°C, 30°C, 37°C)

• Harvesting time (3-24 hours post-induction)

• Codon optimization of the gene sequence for E. coli expression

This systematic approach allows identification of conditions that maximize both yield and solubility of the target protein, which is especially important for proteins of mycobacterial origin that may exhibit expression challenges in E. coli hosts.

What are the best analytical methods to assess purity and integrity of recombinant Rv1842c/MT1890?

Multiple complementary analytical techniques should be employed to thoroughly characterize the recombinant protein:

• SDS-PAGE: Evaluate protein purity and approximate molecular weight. The expected molecular weight of His-tagged Rv1842c/MT1890 is approximately 50-52 kDa. Load equivalent amounts of protein in each lane to assess relative purity, with >90% purity expected after affinity purification .

• Western Blotting: Confirm protein identity using anti-His antibodies or specific antibodies against the Rv1842c protein. This is particularly important when expression levels are low or when multiple bands are present in SDS-PAGE.

• Size Exclusion Chromatography (SEC): Assess protein homogeneity and oligomeric state. This can identify potential aggregates or oligomers that may affect functional studies.

• Mass Spectrometry: Confirm exact molecular mass and verify post-translational modifications or protein integrity.

• Dynamic Light Scattering (DLS): Evaluate protein homogeneity in solution and detect potential aggregation.

• Circular Dichroism (CD): Assess secondary structure content to verify proper protein folding.

For mycobacterial proteins like Rv1842c/MT1890, careful attention to buffer conditions during analysis is essential, as improper buffer composition can lead to protein aggregation or loss of native structure.

What approaches can be used to investigate the function of UPF0053 protein Rv1842c/MT1890?

Investigating the function of proteins of unknown function like UPF0053 Rv1842c/MT1890 requires multiple complementary approaches:

• Bioinformatic Analysis:

  • Sequence homology searches against characterized proteins

  • Structural prediction using tools like AlphaFold

  • Identification of conserved domains and motifs

  • Analysis of genomic context and potential operonic arrangement

• Gene Knockout/Knockdown Studies:

  • Generation of conditional knockdown mutants in M. tuberculosis

  • Analysis of phenotypic effects on growth, morphology, and virulence

  • Complementation studies to confirm specific effects

  • Similar to studies performed for other M. tuberculosis proteins like mIHF

• Protein-Protein Interaction Studies:

  • Pull-down assays using His-tagged Rv1842c/MT1890

  • Bacterial two-hybrid systems

  • Co-immunoprecipitation followed by mass spectrometry

  • Crosslinking studies to capture transient interactions

• Transcriptomic and Proteomic Analysis:

  • RNA-Seq analysis comparing wild-type and mutant strains

  • ChIP-Seq to identify potential DNA binding sites if the protein has DNA-binding properties

  • Comparative proteomics to identify changes in protein expression profiles

• Structural Studies:

  • X-ray crystallography or NMR spectroscopy to determine three-dimensional structure

  • Analysis of potential binding pockets or active sites

  • Structure-guided functional hypothesis generation

These approaches should be conducted systematically, with results from each method informing subsequent experiments to gradually elucidate the protein's function in M. tuberculosis biology.

Could Rv1842c/MT1890 function as a nucleoid-associated protein (NAP) in M. tuberculosis?

Given the context of mycobacterial protein research, it's relevant to consider whether Rv1842c/MT1890 might function as a nucleoid-associated protein (NAP). While this protein has not been definitively characterized as a NAP, several analytical approaches can help investigate this possibility:

• DNA-binding assays: Electrophoretic mobility shift assays (EMSA) with purified recombinant Rv1842c/MT1890 and DNA fragments can test for DNA-binding capability. Both specific and non-specific binding should be evaluated.

• Comparative analysis with known NAPs: Sequence and structural comparison with characterized M. tuberculosis NAPs like HupB, Lsr2, EspR, and mIHF can identify shared domains or motifs associated with DNA binding .

• Chromatin immunoprecipitation sequencing (ChIP-seq): If DNA binding is detected, ChIP-seq analysis using antibodies against Rv1842c/MT1890 can map genomic binding sites, as has been done for other M. tuberculosis NAPs like mIHF .

• Analysis of impacts on nucleoid structure: Generation of conditional knockdown mutants followed by microscopy to assess impacts on nucleoid morphology and bacterial cell architecture.

• Transcriptome analysis: RNA-seq comparing wild-type and mutant strains can reveal whether Rv1842c/MT1890 regulates gene expression patterns typical of NAPs.

Research on other M. tuberculosis proteins initially annotated as NAPs has shown that careful functional characterization is essential. For example, Rv3852, initially annotated as H-NS, was subsequently found not to function as a NAP based on knockout studies and nucleoid analysis .

How can I design experiments to investigate the role of Rv1842c/MT1890 in M. tuberculosis pathogenesis?

Investigating the potential role of Rv1842c/MT1890 in pathogenesis requires a multifaceted approach:

• Generation of knockout or conditional knockdown strains:

  • Create a conditional expression system where protein levels can be modulated

  • Assess effects on bacterial growth, morphology, and stress responses

  • Compare phenotypes to known virulence regulators

• Infection models:

  • Compare wild-type and mutant strains in macrophage infection models

  • Assess bacterial survival, replication, and phagosome escape

  • Evaluate effects on cytokine production and host cell responses

  • Test virulence in animal models (e.g., mouse infection models)

• Stress response analysis:

  • Expose wild-type and mutant strains to relevant stressors (oxidative stress, nitrosative stress, hypoxia, nutrient limitation)

  • Measure growth, survival, and transcriptional responses

  • Compare to known stress response patterns in M. tuberculosis

• Integration with existing pathogenesis data:

  • Analyze expression patterns of Rv1842c/MT1890 in various infection stages

  • Compare with transcriptomic data from in vivo infection models

  • Identify potential regulatory connections with known virulence factors

Similar approaches have been successfully applied to other M. tuberculosis proteins like mIHF, which was found to influence virulence gene expression and bacterial response to host immune system factors .

What are the challenges in expressing and purifying membrane-associated mycobacterial proteins like Rv1842c/MT1890?

The amino acid sequence of Rv1842c/MT1890 suggests it may have membrane-associated characteristics, which presents specific challenges in recombinant expression and purification:

Expression Challenges:

• Toxicity to expression host: Membrane proteins can disrupt E. coli membrane integrity, leading to growth inhibition or cell death

• Protein misfolding and aggregation: Hydrophobic regions may cause improper folding in aqueous environments

• Low expression levels: Membrane proteins often express at lower levels than soluble proteins

Purification Challenges:

• Detergent selection: Identifying appropriate detergents that maintain protein structure while effectively solubilizing the protein

• Maintaining native structure: Ensuring the purified protein retains its functional conformation

• Removing contaminating lipids: Separating bacterial lipids that may co-purify with the target protein

Methodological Solutions:

For Rv1842c/MT1890 specifically, a systematic approach comparing different expression systems, solubility tags, and purification conditions is recommended to optimize both yield and biological activity.

How can I investigate potential interactions between Rv1842c/MT1890 and other M. tuberculosis proteins?

Understanding protein-protein interactions is crucial for elucidating the functional role of Rv1842c/MT1890 in tuberculosis biology. Several complementary approaches can be employed:

• Affinity Purification Mass Spectrometry (AP-MS):

  • Express His-tagged Rv1842c/MT1890 in M. tuberculosis or a surrogate mycobacterial host

  • Perform crosslinking to capture transient interactions

  • Purify protein complexes using affinity chromatography

  • Identify interacting partners by mass spectrometry

  • Validate interactions using complementary methods

• Bacterial Two-Hybrid (B2H) System:

  • Screen for interactions with proteins involved in cell wall synthesis, virulence regulation, or stress response

  • Create fusion constructs with Rv1842c/MT1890 and potential partners

  • Analyze interaction strength through reporter gene activation

  • Validate positive interactions with targeted experiments

• Co-immunoprecipitation (Co-IP):

  • Generate specific antibodies against Rv1842c/MT1890

  • Perform Co-IP from mycobacterial lysates

  • Identify co-precipitating proteins by Western blot or mass spectrometry

  • Confirm bidirectional interaction through reverse Co-IP

• Surface Plasmon Resonance (SPR) or Microscale Thermophoresis (MST):

  • Measure direct binding kinetics between purified Rv1842c/MT1890 and candidate interacting proteins

  • Determine binding affinity (KD) and binding kinetics

  • Investigate the effects of buffer conditions, pH, or small molecules on interaction strength

• Functional Validation:

  • Generate double mutants affecting both Rv1842c/MT1890 and interacting partners

  • Assess phenotypic consequences compared to single mutants

  • Perform complementation studies to confirm specific effects

These methods have been successfully applied to characterize protein interaction networks of other important M. tuberculosis proteins, including nucleoid-associated proteins and virulence factors .

How does research on Rv1842c/MT1890 contribute to the broader understanding of M. tuberculosis biology?

Understanding Rv1842c/MT1890 has potential implications for several key aspects of M. tuberculosis biology:

• Cell Envelope Structure and Function: Based on sequence analysis, Rv1842c/MT1890 may contribute to cell envelope processes, which are critical for M. tuberculosis survival in the host environment and resistance to antibiotics.

• Stress Adaptation: Many proteins of initially unknown function have later been found to participate in adaptation to host-imposed stresses, including oxidative stress, nutrient limitation, and immune pressure.

• Gene Regulation Networks: If Rv1842c/MT1890 functions in gene regulation (directly or indirectly), characterizing its regulon would expand our understanding of transcriptional networks in M. tuberculosis.

• Host-Pathogen Interactions: Proteins involved in bacterial adaptation to the host environment often represent potential targets for therapeutic intervention. Similar research on proteins like mIHF has revealed roles in virulence gene expression and bacterial response to host immune systems .

• Evolutionary Conservation: Analyzing the conservation of Rv1842c/MT1890 across mycobacterial species can provide insights into its evolutionary importance and potential species-specific functions.

The complex gene regulatory network of M. tuberculosis remains incompletely understood. Detailed characterization of proteins like Rv1842c/MT1890 contributes to a more comprehensive understanding of this pathogen, potentially advancing efforts to develop new therapeutic strategies against tuberculosis .

What are the most promising methodologies for studying the structure-function relationship of Rv1842c/MT1890?

Elucidating the structure-function relationship of Rv1842c/MT1890 requires integration of structural biology techniques with functional assays:

• High-Resolution Structure Determination:

  • X-ray crystallography of purified protein (challenges may include obtaining diffraction-quality crystals)

  • Nuclear Magnetic Resonance (NMR) spectroscopy for structure in solution (as successfully applied to mIHF)

  • Cryo-electron microscopy for larger assemblies or membrane-associated forms

• Structure-Guided Mutagenesis:

  • Identify conserved residues through sequence alignment

  • Generate point mutations in key residues identified from structural analysis

  • Assess effects on protein function, stability, and interactions

  • Create domain deletion/swap variants to identify functional regions

• In Silico Approaches:

  • Molecular dynamics simulations to understand protein flexibility and potential conformational changes

  • Docking studies to predict interactions with potential binding partners

  • Evolutionary coupling analysis to identify co-evolving residues suggesting functional importance

• Functional Validation:

  • Compare the effects of wild-type and mutant proteins in appropriate assay systems

  • Assess structure-activity relationships through systematic mutation analysis

  • Complementation studies in knockout strains to confirm structure-function hypotheses

• Integration with Omics Data:

  • Correlate structural features with transcriptomic and proteomic changes observed upon protein depletion

  • Map interaction sites identified through structural studies to functional outcomes

This integrated approach has been successfully applied to other M. tuberculosis proteins, revealing how structural features contribute to their biological functions in processes ranging from gene regulation to stress response .