Recombinant UPF0053 protein Rv2366c/MT2435 (Rv2366c, MT2435)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-435
Protein Length
full length protein
Target Names
Rv2366c, MT2435
Target Protein Sequence
MTGYYQLLGSIVLIGLGGLFAAIDAAISTVSPARVDELVRDQRPGAGSLRKVMADRPRYV NLVVLLRTSCEITATALLVVFIRYHFSMVWGLYLAAGIMVLASFVVVGVGPRTLGRQNAY SISLATALPLRLISWLLMPISRLLVLLGNALTPGRGFRNGPFASEIELREVVDLAQQRGV VAADERRMIESVFELGDTPAREVMVPRTEMIWIESDKTAGQAMTLAVRSGHSRIPVIGEN VDDIVGVVYLKDLVEQTFCSTNGGRETTVARVMRPAVFVPDSKPLDALLREMQRDRNHMA LLVDEYGAIAGLVSIEDVLEEIVGEIADEYDQAETAPVEDLGDKRFRVSARLPIEDVGEL YGVEFDDDLDVDTVGGLLALELGRVPLPGAEVISHGLRLHAEGGTDHRGRVRIGTVLLSP AEPDGADDEEADHPG
Uniprot No.

Q&A

What is the complete structural profile of UPF0053 protein Rv2366c/MT2435?

The UPF0053 protein Rv2366c/MT2435 is a full-length protein from Mycobacterium tuberculosis with distinct structural domains. Similar to other proteins in this family, it likely contains conserved regions typical of UPF (Uncharacterized Protein Family) proteins. Structural analysis would typically involve X-ray crystallography or cryo-electron microscopy to determine tertiary structure. While specific structural data for this exact protein is limited, research on similar UPF0053 proteins shows they typically contain alpha-helical regions that may undergo conformational changes affecting protein function .

How does the amino acid sequence of Rv2366c/MT2435 compare to other UPF0053 family proteins?

Sequence alignment analysis of Rv2366c/MT2435 with other UPF0053 family proteins shows conserved domains characteristic of this protein family. Like similar proteins such as Rv1842c/MT1890, it contains specific regions that define its classification within the UPF0053 group . Phylogenetic analysis would typically reveal evolutionary relationships with other mycobacterial proteins. Researchers should perform multiple sequence alignment using tools like CLUSTAL Omega or MUSCLE to identify conserved residues that might be crucial for protein function.

What expression systems are most effective for recombinant production of Rv2366c/MT2435?

For optimal recombinant expression of Rv2366c/MT2435, E. coli-based expression systems have shown promising results. Specifically, BL21(DE3)pLysS strains can be used with appropriate expression vectors such as pET systems . Expression optimization typically requires:

ParameterRecommended ConditionNotes
IPTG Concentration0.01-0.04%Lower concentrations may reduce toxicity
Temperature37°CAlternative temperatures (16-30°C) may improve solubility
Culture Duration4-6 hours post-inductionMonitored by OD600 measurements
MediaLB with appropriate antibioticsSpecialized media can increase yield

Growth curve measurements should be performed to determine optimal harvesting time, as expression of certain mycobacterial proteins may affect E. coli growth rates .

What are the predicted biological functions of Rv2366c/MT2435 based on structural homology?

While the specific functions of UPF0053 protein Rv2366c/MT2435 are not fully characterized, structural homology analysis suggests potential roles in cellular processes. Based on studies of related proteins, it may be involved in stress response pathways or cellular adaptation mechanisms in Mycobacterium tuberculosis . Homology modeling using related proteins with known functions can provide insights into potential biochemical activities. The protein might participate in similar pathways as other mycobacterial proteins, potentially including roles in drug resistance mechanisms or cellular persistence under stress conditions.

How can researchers experimentally determine protein-protein interactions for Rv2366c/MT2435?

Several methodological approaches are recommended for determining protein-protein interactions:

  • Yeast two-hybrid screening: Allows identification of direct protein interactions by expressing Rv2366c/MT2435 as bait against a Mycobacterium tuberculosis library

  • Co-immunoprecipitation (Co-IP): Using specific antibodies against Rv2366c/MT2435 to pull down interaction partners

  • Pull-down assays: Using tagged recombinant Rv2366c/MT2435 protein with mycobacterial lysates

  • Bacterial two-hybrid systems: Particularly useful for prokaryotic protein interactions

  • Surface plasmon resonance (SPR): For quantitative analysis of binding affinity with candidate interaction partners

Data analysis should include validation of interactions through multiple methodologies and confirmation in physiologically relevant conditions .

What experimental approaches best characterize enzymatic activities of UPF0053 proteins like Rv2366c/MT2435?

Characterizing potential enzymatic activities of Rv2366c/MT2435 requires systematic biochemical analysis:

  • Activity screening using substrate libraries to identify potential enzymatic functions

  • Spectrophotometric assays to monitor potential catalytic activities

  • Investigation of cofactor requirements through metal ion dependency tests

  • Kinetic analysis to determine reaction parameters (Km, Vmax, kcat)

  • Structural studies of protein-substrate complexes through co-crystallization

Researchers should consider that UPF0053 proteins might function in multiprotein complexes, so activity may depend on the presence of cofactors or binding partners not present in simple in vitro assays .

What transcriptional factors regulate Rv2366c/MT2435 expression under different stress conditions?

The transcriptional regulation of Rv2366c/MT2435 can be studied through several approaches:

  • Promoter analysis using reporter gene assays to identify regulatory elements

  • ChIP-seq to identify transcription factors binding to the promoter region

  • RNA-seq analysis under various stress conditions to determine expression patterns

  • Electrophoretic mobility shift assays (EMSA) to confirm specific protein-DNA interactions

Similar mycobacterial genes show differential expression under conditions like oxidative stress, nutrient starvation, and exposure to antibiotics. For instance, genes like Rv0678 show altered expression patterns during drug exposure, suggesting potential regulatory mechanisms that might also affect Rv2366c/MT2435 .

How does Rv2366c/MT2435 expression change during different growth phases and drug exposures?

Expression profiling studies can reveal how Rv2366c/MT2435 levels change during bacterial growth and in response to antimicrobial compounds:

Growth Phase/ConditionExpression PatternExperimental Approach
Log PhaseBaseline expression levelsRT-qPCR, RNA-seq
Stationary PhasePotential upregulationTime-course RNA-seq
Drug Exposure (e.g., bedaquiline)Altered expression patternsComparative transcriptomics
Nutrient LimitationPotential stress responseControlled culture conditions
Macrophage InfectionHost-induced expression changesInfection models with RNA extraction

Similar mycobacterial proteins show specific expression patterns in response to drug exposure. For example, Rv0678 variants emerge during bedaquiline exposure, suggesting potential roles in adaptive responses .

What roles might Rv2366c/MT2435 play in Mycobacterium tuberculosis drug resistance mechanisms?

Investigation into potential roles of Rv2366c/MT2435 in drug resistance should consider:

  • Analysis of variant frequencies in clinical isolates with drug resistance

  • Generation of knockout or overexpression strains to assess MIC changes for various antibiotics

  • Structural modeling of potential interactions with drug compounds

  • Transcriptomic analysis comparing expression in susceptible versus resistant strains

Research on mycobacterial proteins has identified several mechanisms involved in resistance. For example, variants in genes like Rv0678 and atpE have been associated with bedaquiline resistance, with MIC increases above critical concentrations . Similar methodological approaches could reveal whether Rv2366c/MT2435 contributes to resistance phenotypes.

How can site-directed mutagenesis of Rv2366c/MT2435 reveal structure-function relationships?

A systematic site-directed mutagenesis approach should target:

  • Conserved residues identified through multiple sequence alignments

  • Predicted functional domains based on structural modeling

  • Potential interaction interfaces identified through computational prediction

  • Residues homologous to known functional sites in related proteins

The experimental workflow should include:

  • Generation of mutant constructs using overlap extension PCR or similar methods

  • Expression and purification of mutant proteins

  • Comparative functional assays against wild-type protein

  • Structural analysis of mutants to assess conformational changes

Similar approaches have revealed important structure-function relationships in other mycobacterial proteins. For instance, the "linker" region in Rv2528c shows distinct structural features compared to homologous proteins, with translocated α-helices potentially affecting domain orientation and function .

What experimental models best evaluate the immunological significance of Rv2366c/MT2435?

To assess potential immunological relevance of Rv2366c/MT2435:

  • Macrophage infection models using wild-type and Rv2366c/MT2435 knockout strains

  • Analysis of cytokine profiles induced by purified recombinant protein

  • T-cell epitope mapping using synthetic peptide libraries

  • Animal models comparing virulence of knockout versus complemented strains

  • Human PBMC stimulation assays to assess immunogenicity

These approaches would help determine if Rv2366c/MT2435 contributes to host immune responses or immune evasion mechanisms that might influence tuberculosis pathogenesis.

What purification strategies optimize yield and purity of recombinant Rv2366c/MT2435?

Optimized purification protocols for Rv2366c/MT2435 should consider:

Purification StepRecommended ApproachCritical Parameters
Affinity ChromatographyHis-tag purificationImidazole concentration gradient, pH optimization
Ion ExchangeBased on theoretical pISalt gradient optimization
Size ExclusionSeparation of aggregatesBuffer composition to prevent aggregation
Tag RemovalProtease cleavageEnzyme selection, cleavage conditions
Endotoxin RemovalFor immunological studiesValidation with LAL assay

Recombinant mycobacterial proteins can present purification challenges, including inclusion body formation. For optimal results, researchers should test various solubility enhancers (detergents, chaperones) and refolding protocols if the protein forms inclusion bodies .

What analytical methods best characterize post-translational modifications of Rv2366c/MT2435?

Comprehensive characterization of post-translational modifications (PTMs) requires:

  • Mass spectrometry analysis:

    • Bottom-up proteomics with tryptic digestion

    • Top-down analysis of intact protein

    • Targeted MS/MS for specific modifications

  • Specific modification detection:

    • Phosphorylation: Phos-tag gels, phospho-specific antibodies

    • Glycosylation: Lectin blotting, PNGase treatment

    • Methylation/acetylation: Modification-specific antibodies

  • Functional impact assessment:

    • Site-directed mutagenesis of modified residues

    • Comparative activity assays

PTMs can significantly impact protein function, and their characterization is essential for understanding the protein's biological role in different physiological contexts.

How can molecular dynamics simulations provide insights into Rv2366c/MT2435 function?

Molecular dynamics (MD) simulations offer valuable insights into protein behavior:

  • Protocol development:

    • System preparation with appropriate force fields

    • Equilibration followed by production runs (typically 100-500 ns)

    • Analysis of trajectory for conformational changes

  • Key parameters to analyze:

    • Root mean square deviation/fluctuation (RMSD/RMSF)

    • Secondary structure stability

    • Solvent accessible surface area

    • Potential binding pocket dynamics

  • Advanced applications:

    • Ligand binding simulations

    • Protein-protein interaction analysis

    • Conformational changes under different conditions

Similar approaches have revealed important structural dynamics in mycobacterial proteins. For example, comparative modeling of Rv2528c identified structural differences in the "linker" region compared to homologous proteins, with potential functional implications .

What bioinformatic approaches best predict novel functions for UPF0053 family proteins like Rv2366c/MT2435?

Comprehensive functional prediction requires integrating multiple computational approaches:

  • Sequence-based methods:

    • Hidden Markov Models for remote homology detection

    • Analysis of conserved motifs and domains

    • Genomic context analysis (gene neighborhood)

  • Structure-based prediction:

    • Threading and fold recognition

    • Active site template matching

    • Binding pocket analysis

  • Systems biology approaches:

    • Protein-protein interaction network analysis

    • Co-expression patterns with functionally characterized genes

    • Phylogenetic profiling across bacterial species

These approaches can generate testable hypotheses about protein function that guide experimental design for functional characterization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.