Recombinant UPF0056 inner membrane protein yhgN (yhgN)

Shipped with Ice Packs
In Stock

Description

Production and Expression Systems

Commercial variants are produced using diverse methodologies:

Expression SystemTagYieldPrice (USD)Catalog Number
Cell-free synthesisHis0.02 mg$1,480MBS7034511
E. coli (K12)HisLyophilized$820+MBS1233796
Shigella flexneriHis50 µgInquireRFL3818SF

Key production notes:

  • Requires reconstitution in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage

  • Avoids repeated freeze-thaw cycles; stable at -80°C for years

Functional Annotations

While full biological roles remain under investigation, current data suggest:

Proposed Functions

  • Antibiotic transporter: Implicated in multidrug resistance through substrate efflux

  • Nucleotide metabolism: dITP/XTP hydrolase activity observed in E. coli O157:H7 variants

  • Membrane organization: Interacts with lipid bilayers via six transmembrane helices

Pathway Associations
Though specific pathways are uncharacterized, paralogs (marC, ychE) participate in:

  • Membrane transport systems

  • Stress response mechanisms

Research Applications

This recombinant protein serves as critical material for:

Antibody Development

  • Rabbit polyclonal antibodies show reactivity in ELISA/Western blot across E. coli K12, O157:H7, and Shigella flexneri

Comparative Microbiology

  • Enables functional studies across Enterobacteriaceae through ortholog production:

    • E. coli K12 (UniProt: P67143)

    • E. coli O157:H7 (UniProt: P67144)

    • Shigella flexneri (Locus: SF3457)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be finalized during production. If you have a preferred tag type, please inform us, and we will prioritize developing it according to your specifications.
Synonyms
yhgN; Z4798; ECs4279; UPF0056 inner membrane protein YhgN
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-197
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
yhgN
Target Protein Sequence
MNEIISAAVLLILIMDPLGNLPIFMSVLKHTEPKRRRAIMVRELLIALLVMLVFLFAGEK ILAFLSLRAETVSISGGIILFLIAIKMIFPSASGNSSGLPAGEEPFIVPLAIPLVAGPTI LATLMLLSHQYPNQMGHLVIALLLAWGGTFVILLQSSLFLRLLGEKGVNALERLMGLILV MMATQMFLDGIRMWMKG
Uniprot No.

Target Background

Database Links

KEGG: ece:Z4798

STRING: 155864.Z4798

Protein Families
UPF0056 (MarC) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0056 inner membrane protein yhgN and what are its known functions?

UPF0056 inner membrane protein yhgN is a bacterial protein primarily found in Escherichia coli and related enterobacteria. Based on current research, this protein has multiple proposed functions including roles as an antibiotic transporter and as a dITP- and XTP-hydrolase . The protein belongs to the UPF0056 family of inner membrane proteins, which are characterized by their transmembrane topology and conserved structural domains. Despite being identified in numerous bacterial genomes, the precise biological function of yhgN remains under investigation, with evidence suggesting roles in nucleotide metabolism and potentially in antibiotic resistance mechanisms . The gene encoding yhgN has been mapped to specific loci in different bacterial strains (for example, identified as ECK3420 and JW3397 in E. coli K12) .

How can I verify the integrity and purity of recombinant yhgN preparations?

Verification of recombinant yhgN protein integrity and purity typically employs multiple analytical techniques. SDS-PAGE analysis is the primary method for assessing purity, with commercial preparations typically achieving ≥85% purity . For identity confirmation, Western blotting using specific anti-yhgN antibodies is recommended, with antibodies available against yhgN from different bacterial species including E. coli strain K12, E. coli O157:H7, and Shigella flexneri . Mass spectrometry can provide additional verification of protein identity and detect any unexpected post-translational modifications. For functional integrity assessment, enzyme activity assays measuring dITP- and XTP-hydrolase activity can be employed when studying yhgN's enzymatic functions. Circular dichroism spectroscopy may also be useful for confirming proper secondary structure formation, particularly important for membrane proteins.

What are the optimal methods for isolating yhgN from bacterial membrane fractions?

The isolation of yhgN from bacterial membrane fractions requires specialized techniques to separate inner membrane components. An effective approach involves a combination of differential centrifugation and detergent-based extraction. Initially, bacterial cells should be disrupted using French pressure cell disruption or sonication methods. The membrane fraction can then be isolated by ultracentrifugation at approximately 100,000g for 1 hour at 4°C . For selective extraction of inner membrane proteins like yhgN, a selective detergent solubilization approach using N-lauroylsarcosine (Sarkosyl) at 1% (w/v) concentration is effective . This detergent preferentially solubilizes inner membrane proteins while leaving outer membrane components insoluble. The solubilized fraction containing yhgN can be recovered by ultracentrifugation and further purified using affinity chromatography if the recombinant protein contains an affinity tag.

How can sucrose density gradient centrifugation be optimized for yhgN membrane protein isolation?

Sucrose density gradient centrifugation represents a refined approach for separating membrane fractions containing yhgN with high purity. The protocol begins with preparing double-washed membrane fractions from bacterial cultures. After cell lysis using French pressure cell disruption, the lysate should be centrifuged at 10,000g to remove cellular debris . The resulting supernatant is then ultracentrifuged at 100,000g for 60 minutes at 4°C to pellet total membranes. This membrane pellet should be washed in 10 mM HEPES, 0.05 M EDTA pH 7.5 buffer and recentrifuged . For the gradient separation, carefully layer the resuspended membrane preparation onto a discontinuous sucrose gradient (typically ranging from 20% to 70% sucrose) and ultracentrifuge for 16-18 hours at 100,000g. Distinct bands corresponding to different membrane fractions will form, with inner membrane fractions containing yhgN typically appearing at specific density interfaces that can be carefully collected, diluted with buffer, and concentrated by ultracentrifugation. This method provides superior resolution of membrane fractions compared to simple differential centrifugation.

What detergents are most effective for solubilizing yhgN while maintaining its structural integrity?

The selection of appropriate detergents is critical for effective solubilization of yhgN while preserving its structural and functional properties. Mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) and digitonin are often preferred for initial extraction as they maintain protein-protein interactions and tertiary structure. N-lauroylsarcosine (Sarkosyl) at 1% concentration offers selective solubilization of inner membrane proteins . For structural studies requiring complete delipidation, stronger detergents like LDAO (lauryldimethylamine oxide) may be employed, though with careful monitoring of protein stability. The critical micelle concentration (CMC) of the selected detergent must be considered when designing purification strategies, with detergent concentration typically maintained above the CMC throughout purification steps to prevent protein aggregation. For functional studies, detergent screening is recommended to identify conditions that preserve yhgN's enzymatic activities (dITP- and XTP-hydrolase function or antibiotic transport capabilities).

What experimental approaches are recommended for studying the antibiotic transport function of yhgN?

The antibiotic transport function attributed to yhgN can be studied through several complementary approaches. Liposome reconstitution assays represent a powerful method, where purified recombinant yhgN is incorporated into artificial lipid vesicles loaded with fluorescent antibiotic analogs. Measurement of fluorescence changes over time can quantify transport activity. Alternatively, whole-cell accumulation assays using radio-labeled or fluorescently labeled antibiotics can assess yhgN's role in antibiotic uptake or efflux by comparing wild-type cells with yhgN knockout mutants or yhgN-overexpressing strains. Electrophysiological techniques such as planar lipid bilayer recordings can directly measure transport activity by detecting ion currents associated with antibiotic translocation. For structure-function analyses, site-directed mutagenesis of conserved residues followed by functional assays can identify amino acids critical for transport activity. Computational approaches including molecular dynamics simulations can further predict binding sites and transport mechanisms to guide experimental design.

How can the dITP- and XTP-hydrolase activity of yhgN be accurately measured and characterized?

Accurate measurement of yhgN's dITP- and XTP-hydrolase activity requires carefully designed enzymatic assays. A standard approach involves incubating purified recombinant yhgN with substrate nucleotides (dITP or XTP) under controlled conditions and quantifying reaction products. High-performance liquid chromatography (HPLC) with UV detection offers precise quantification of substrate depletion and product formation. For continuous monitoring of hydrolysis rates, coupled enzyme assays can be employed where the release of inorganic phosphate is linked to a colorimetric or fluorometric readout. Enzyme kinetic parameters (Km, Vmax, kcat) should be determined under varied substrate concentrations, and the influence of pH, temperature, and metal ion cofactors should be systematically evaluated to establish optimal reaction conditions. Specificity studies comparing hydrolysis rates of various nucleotide substrates (dITP, XTP, dGTP, ITP, etc.) can provide insights into substrate recognition mechanisms. Inhibitor studies using nucleotide analogs may further characterize the active site properties.

What structural biology techniques are most informative for understanding yhgN membrane insertion and topology?

Understanding the membrane insertion and topology of yhgN requires specialized structural biology approaches tailored for membrane proteins. Cysteine scanning mutagenesis combined with accessibility measurements using membrane-impermeable sulfhydryl reagents can map transmembrane segments and their orientation. Protease protection assays, where purified membranes containing yhgN are subjected to controlled proteolytic digestion followed by immuno-detection of fragments, can identify domains exposed on either side of the membrane. For higher-resolution structural information, X-ray crystallography of detergent-solubilized or lipidic cubic phase-reconstituted yhgN can be attempted, though this presents significant technical challenges. Cryo-electron microscopy (cryo-EM) offers an alternative approach that may capture the protein in a more native-like environment. Computational prediction tools specifically developed for membrane proteins can complement experimental approaches by generating testable topology models based on amino acid sequence analysis. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide insights into dynamic aspects of membrane insertion by identifying regions with differential solvent accessibility.

How can yhgN be employed in antibiotic resistance mechanism studies?

The yhgN protein's predicted role as an antibiotic transporter positions it as a valuable model for studying membrane-based antibiotic resistance mechanisms. Research approaches should include comparative expression analysis of yhgN in antibiotic-resistant versus susceptible bacterial strains using RT-qPCR and Western blotting to correlate expression levels with resistance phenotypes. Gene knockout and complementation studies using CRISPR-Cas9 or homologous recombination techniques can establish causal relationships between yhgN function and antibiotic susceptibility profiles. For mechanistic insights, antibiotic accumulation assays comparing intracellular antibiotic concentrations in wild-type versus yhgN-modified strains can reveal efflux or reduced uptake phenotypes. Structure-based drug design approaches targeting yhgN may identify novel efflux pump inhibitors to overcome resistance. Heterologous expression of yhgN in antibiotic-susceptible model organisms followed by susceptibility testing can validate its direct contribution to resistance. Systems biology approaches integrating transcriptomic and proteomic data may identify regulatory networks controlling yhgN expression in response to antibiotic exposure, providing broader insights into adaptive resistance mechanisms.

What experimental designs best address the conflicting functional annotations of yhgN (antibiotic transporter vs. nucleotide hydrolase)?

The conflicting functional annotations of yhgN as both an antibiotic transporter and a nucleotide hydrolase represent an intriguing research question requiring carefully designed experiments. A comprehensive approach would begin with domain analysis and homology modeling to identify structurally distinct regions potentially responsible for different functions. Parallel purification and functional characterization of the full-length protein and domain-specific constructs could determine whether both activities reside in the same protein or result from annotation errors. Activity correlation studies examining whether nucleotide hydrolysis influences transport function (or vice versa) might reveal functional coupling. Cross-species comparative biochemistry using yhgN orthologs with divergent annotated functions could identify evolutionary patterns in dual functionality. Structural studies including X-ray crystallography or cryo-EM with and without bound substrates/antibiotics would provide definitive evidence of binding sites. Cellular localization studies using fluorescently tagged yhgN variants combined with activity assays might determine whether subcellular distribution influences functional specialization. Systems-level approaches examining metabolic pathways affected by yhgN perturbation could reveal which function predominates under specific physiological conditions.

How can synthetic biology approaches leverage yhgN for developing novel biosensors or biocontainment strategies?

The dual functionality of yhgN as both a membrane transporter and an enzyme presents unique opportunities for synthetic biology applications. For biosensor development, the protein's antibiotic transport capability could be engineered to create whole-cell biosensors for detecting antimicrobial compounds in environmental samples. This might involve coupling yhgN expression to reporter systems such as fluorescent proteins or luciferase, with signal generation dependent on successful transport. Alternatively, the nucleotide hydrolase activity could be repurposed to create biosensors for detecting modified nucleotides or related compounds. For biocontainment strategies, engineered yhgN variants with modified substrate specificity could be incorporated into synthetic auxotrophy systems, where engineered microorganisms depend on yhgN-mediated import of essential nutrients not found in natural environments. Directed evolution approaches could generate yhgN variants with enhanced specificity for particular antibiotics or nucleotides, expanding the toolkit available for synthetic biology applications. Protein engineering employing computational design followed by high-throughput screening could create yhgN variants with novel functions entirely distinct from the native protein. Integration of yhgN into synthetic genetic circuits might enable sophisticated cellular behaviors responsive to specific environmental conditions detected through yhgN-mediated sensing.

What are the common challenges in achieving high expression yields of recombinant yhgN and how can they be overcome?

Achieving high expression yields of recombinant yhgN presents several challenges common to membrane proteins. Toxicity to host cells often limits expression, which can be addressed by using tightly regulated inducible promoters, lowering induction temperature to 16-20°C, or employing specialized E. coli strains like C41(DE3) and C43(DE3) designed for toxic membrane protein expression. Protein aggregation and inclusion body formation may be mitigated by co-expression with molecular chaperones, addition of mild detergents to growth media, or fusion with solubility-enhancing tags like MBP or SUMO. Inefficient membrane insertion can be improved by optimizing signal sequences or using specialized membrane protein expression vectors. For eukaryotic expression systems, codon optimization for the host organism and careful selection of cell lines with robust secretory pathways can enhance yields. Cell-free expression systems offer an alternative approach that bypasses cytotoxicity issues, with recent advances in adding nanodiscs or liposomes to cell-free reactions improving membrane protein folding . Systematic screening of expression conditions including media composition, induction parameters, and harvest timing can identify optimal protocols for specific yhgN constructs.

How should researchers address inconsistent results in yhgN functional assays?

Inconsistent results in yhgN functional assays can stem from multiple sources that require systematic troubleshooting. Variability in protein preparation quality should be assessed using multiple analytical methods including size-exclusion chromatography to verify monodispersity and proper oligomeric state. The influence of different detergents on activity should be systematically evaluated, as detergent micelles may inadequately mimic the native membrane environment. Reconstitution into liposomes with defined lipid compositions more closely resembling bacterial inner membranes may provide more consistent functional data. For enzymatic assays, substrate purity should be verified, as commercial nucleotide preparations may contain inhibitory contaminants. Buffer components including pH, ionic strength, and specific ions (particularly divalent cations which often influence nucleotide hydrolysis) should be carefully controlled and optimized. Temperature sensitivity of yhgN may lead to activity loss during experimental procedures, necessitating strict temperature control throughout purification and assay steps. For antibiotic transport assays, the physical state of the antibiotic (aggregated vs. monomeric) can significantly impact results and should be carefully controlled. Standardization of protocols across laboratory members and detailed documentation of experimental conditions are essential for isolating sources of variability.

What quality control measures are essential when working with antibodies against yhgN in research applications?

Working with antibodies against yhgN requires rigorous quality control measures to ensure experimental reliability. Validation of antibody specificity should be performed using multiple complementary approaches including Western blotting against wild-type samples versus yhgN knockout controls. Cross-reactivity testing against related bacterial species is essential when studying yhgN across different organisms, as sequence variations may affect epitope recognition . Batch-to-batch consistency should be verified for each new antibody lot using standardized positive control samples. For quantitative applications, standard curves using purified recombinant yhgN should be established to verify linear detection ranges. When using anti-yhgN antibodies for immunoprecipitation or chromatin immunoprecipitation studies, pull-down efficiency should be quantified and optimized. The influence of sample preparation methods on epitope preservation should be evaluated, particularly for conformational epitopes that may be sensitive to denaturation. Proper controls including secondary antibody-only controls, isotype controls, and pre-immune serum controls should be incorporated into experimental designs. Long-term storage conditions including aliquoting to prevent freeze-thaw cycles and addition of preservatives appropriate for the specific application should be established to maintain antibody performance over time.

How should researchers interpret discrepancies between in vitro and in vivo findings regarding yhgN function?

Discrepancies between in vitro and in vivo findings regarding yhgN function require careful interpretation considering multiple factors. The artificial environment of in vitro systems may lack crucial components present in the cellular context, such as interaction partners, specific lipid microdomains, or physiological ion gradients that influence yhgN activity. Comparative analysis of purification methods should be conducted to determine whether functional differences arise from protein denaturation or modification during extraction. The physiological relevance of substrate concentrations used in vitro versus those present in vivo should be evaluated, as concentration differences can shift reaction kinetics or transport properties. Post-translational modifications present in vivo but absent in recombinant systems may account for functional differences and should be characterized using mass spectrometry. Compensatory mechanisms in knockout models, including upregulation of proteins with redundant functions, may mask phenotypes expected based on in vitro activity. Time-dependent changes in protein activity or localization may be captured differently in acute in vitro assays versus chronic in vivo models. Integration of multiple experimental approaches including biochemical assays, structural studies, cellular imaging, and genetic models provides the most comprehensive understanding of yhgN function, with discrepancies potentially revealing novel regulatory mechanisms rather than experimental artifacts.

What statistical approaches are most appropriate for analyzing yhgN enzymatic kinetics data?

Analysis of yhgN enzymatic kinetics requires appropriate statistical methods to derive meaningful mechanistic insights. For basic Michaelis-Menten kinetic parameters, non-linear regression analysis should be employed rather than linear transformations (like Lineweaver-Burk plots) which unevenly weight data points. Confidence intervals for Km and Vmax should be reported rather than simple point estimates. When comparing kinetic parameters across experimental conditions or mutant variants, analysis of variance (ANOVA) with appropriate post-hoc tests should be used to determine statistical significance while controlling for multiple comparisons. For complex kinetic mechanisms involving multiple substrates or allosteric effects, global fitting of data to appropriate mathematical models using specialized enzyme kinetics software is recommended. Bootstrap resampling approaches can provide robust parameter estimates when working with limited data sets. Outlier analysis should be performed using objective statistical criteria rather than subjective removal of "bad" data points. For time-course experiments, repeated measures ANOVA or mixed-effects models may be more appropriate than simple endpoint comparisons. When testing competitive inhibitors, the mode of inhibition should be determined by examining changes in apparent Km and Vmax values, with statistical comparison of different inhibition models (competitive, uncompetitive, non-competitive) using measures like Akaike Information Criterion.

How can researchers effectively compare yhgN structure-function relationships across different bacterial species?

Comparing yhgN structure-function relationships across bacterial species requires integrated computational and experimental approaches. Sequence alignment and phylogenetic analysis should first establish evolutionary relationships between yhgN homologs, identifying conserved domains and species-specific variations. Homology modeling based on available structures of related proteins can predict structural differences that might influence function. Complementation studies, where yhgN from different species is expressed in a common model organism lacking endogenous yhgN, provide direct functional comparison in a controlled genetic background. Biochemical characterization of recombinant proteins from multiple species under identical conditions allows direct comparison of kinetic parameters, substrate specificities, and inhibitor sensitivities. Domain swapping experiments, creating chimeric proteins with regions from different species, can identify domains responsible for species-specific functional differences. Structural studies using techniques like hydrogen-deuterium exchange mass spectrometry can map dynamic regions that might differ between orthologs despite sequence conservation. Computational molecular dynamics simulations can predict how sequence variations influence protein dynamics in membrane environments. Integration of these approaches with ecological and physiological context (considering the different environments inhabited by source organisms) can reveal adaptive specialization of yhgN function across bacterial species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.