Recombinant UPF0059 membrane protein BA_5567/GBAA_5567/BAS5173 (BA_5567, GBAA_5567, BAS5173)

What is the molecular structure of UPF0059 membrane protein BA_5567/GBAA_5567/BAS5173?

Q: What is the complete amino acid sequence of this protein?

A: The full 182-amino acid sequence of UPF0059 membrane protein BA_5567/GBAA_5567/BAS5173 is: MTFEQLIPLIIMAFALGMDAFSVSLGMGMMALKIRQILYIGVTIGIFHIIMPFIGMVLGRFLSEQYGDIAHFAGAILLIGLGFYIVYSSILENEETRTAPIGISLFVFAFGVSIDSFSVGLSLGIYGAQTIITILLFGFVSMLLAWIGLLIGRHAKGMLGTYGEIVGGIILVGFGLYLLFPI . This sequence reveals multiple hydrophobic regions consistent with transmembrane domains typical of integral membrane proteins.

Q: Are there available 3D structure models for this protein?

A: While high-resolution crystal structures have not been reported in the provided literature, ModBase offers a computational 3D structure model for this protein under UniProt ID Q81JX6 . Researchers should note that computational models provide theoretical structural insights that require experimental validation through techniques such as X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy.

Q: What post-translational modifications are associated with this protein?

What expression systems are optimal for recombinant production?

Q: Which expression system provides the highest yield for this membrane protein?

A: E. coli expression systems offer the best yields with shorter turnaround times for UPF0059 membrane protein BA_5567/GBAA_5567/BAS5173 . Specific products described in the literature include His-tagged versions expressed in E. coli with greater than 90% purity as determined by SDS-PAGE . Yeast expression systems also provide good yields, while insect and mammalian cells are recommended when post-translational modifications are critical .

Q: How does cell-free expression compare to cellular systems for this protein?

A: Cell-free expression systems have been successfully employed for producing this transmembrane protein . This approach can be advantageous for membrane proteins as it bypasses cellular toxicity issues that often arise with overexpression of membrane proteins in living cells. The cell-free approach may provide faster production timelines, though optimization of reaction components and conditions is essential for maximizing yield and functionality.

Q: What purification strategies are most effective for maintaining protein stability?

A: Based on commercial preparations, effective purification typically involves affinity chromatography for tagged versions of the protein. The recombinant protein is commonly provided in stabilizing buffers containing either Tris-based buffer with 50% glycerol or Tris/PBS-based buffer with 6% trehalose at pH 8.0 . These formulations are specifically optimized to maintain protein stability during storage and handling.

What are the optimal storage and handling conditions?

Q: How should this protein be stored to maximize stability and shelf life?

A: The optimal storage conditions for UPF0059 membrane protein BA_5567/GBAA_5567/BAS5173 are -20°C for routine storage and -80°C for extended storage . The protein is typically stabilized in buffer containing 50% glycerol or 6% trehalose. Importantly, repeated freezing and thawing cycles should be avoided as they can compromise protein integrity and function . For working aliquots, storage at 4°C for up to one week is recommended .

Q: What reconstitution protocol is recommended for lyophilized preparations?

A: For reconstitution of lyophilized preparations, first centrifuge the vial briefly to bring contents to the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage after reconstitution, the addition of 5-50% glycerol (final concentration) is recommended, with a default final concentration of 50% glycerol being commonly used . The reconstituted protein should be aliquoted to minimize freeze-thaw cycles.

How can researchers design functional studies for this uncharacterized protein?

Q: What experimental approaches can elucidate the potential manganese transport function?

A: To investigate the potential manganese efflux pump activity suggested by the MntP annotation , researchers should implement a multi-faceted approach:

• Metal transport assays using proteoliposomes reconstituted with purified protein

• Fluorescent metal-sensing probes to measure manganese transport in real-time

• Isotope-labeled manganese (⁵⁴Mn) uptake/efflux studies

• Electrophysiological measurements if channel-like activity is suspected

• Growth complementation assays in yeast or bacterial strains deficient in manganese transport

• Site-directed mutagenesis of predicted metal-binding residues followed by functional assessment

Each approach should include appropriate controls such as inactive mutants, unrelated membrane proteins, and empty liposomes to establish specificity.

Q: How can protein-lipid interactions be studied for this membrane protein?

A: To characterize protein-lipid interactions, researchers should consider:

• Differential scanning calorimetry to measure thermodynamic parameters of protein-lipid interactions

• Fluorescence anisotropy with labeled lipids to measure direct binding

• Native mass spectrometry to identify specifically bound lipids

• Molecular dynamics simulations to predict lipid binding sites

• Reconstitution in nanodiscs with defined lipid composition to assess functional impact

• Tryptophan fluorescence quenching to monitor conformational changes upon lipid binding

These approaches will help determine whether specific lipids are required for structural stability or functional activity of the UPF0059 membrane protein.

What analytical techniques are appropriate for structural characterization?

Q: Which methods can provide high-resolution structural information?

A: For high-resolution structural characterization of UPF0059 membrane protein BA_5567/GBAA_5567/BAS5173, researchers should consider:

• X-ray crystallography: Requires successful crystallization, which can be challenging for membrane proteins

• Cryo-electron microscopy: Increasingly powerful for membrane proteins without crystallization

• Solution or solid-state NMR: Particularly useful for dynamic regions and ligand binding studies

• Hydrogen-deuterium exchange mass spectrometry: Provides insights into solvent-accessible regions

• Small-angle X-ray scattering (SAXS): Yields low-resolution envelope structures in solution

Each method has distinct advantages and limitations for membrane protein analysis, and a combination of approaches may provide complementary structural insights.

Q: How can researchers assess oligomerization state in membrane environments?

A: To determine the oligomerization state of the UPF0059 membrane protein:

• Blue native PAGE to analyze native complexes

• Chemical crosslinking followed by SDS-PAGE or mass spectrometry analysis

• Analytical ultracentrifugation with detergent-solubilized protein

• Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

• Single-molecule fluorescence techniques such as step photobleaching

• Förster resonance energy transfer (FRET) between labeled protein units

Understanding oligomerization is critical as it may correlate with functional state, particularly for transport proteins.

What approaches help resolve data contradictions in membrane protein research?

Q: How can researchers address inconsistent functional data from different expression systems?

A: When facing contradictory functional data from different expression systems:

• Systematically compare protein modifications between expression systems using mass spectrometry

• Assess lipid composition differences that might affect function

• Verify protein folding using circular dichroism or intrinsic fluorescence

• Implement activity assays in defined reconstituted systems with identical lipid composition

• Evaluate the impact of purification methods on protein stability and activity

• Use complementary functional assays that measure different aspects of the same activity

This systematic approach helps distinguish genuine functional differences from artifacts introduced by experimental conditions.

Q: What strategies help reconcile structural predictions with experimental observations?

A: To resolve discrepancies between computational predictions and experimental data:

• Refine computational models using experimental constraints

• Implement hybrid approaches combining low-resolution experimental data with computational modeling

• Test structure-based functional predictions through site-directed mutagenesis

• Consider protein dynamics rather than static structures alone

• Assess environmental factors (pH, ionic strength, lipid composition) that might induce conformational changes

• Develop experimentally-validated scoring functions for computational predictions

What reconstitution techniques preserve native function?

Q: How can this membrane protein be effectively reconstituted into liposomes?

A: For functional reconstitution of UPF0059 membrane protein BA_5567/GBAA_5567/BAS5173 into liposomes:

• Select appropriate lipid composition, potentially starting with E. coli polar lipid extract

• Optimize protein-to-lipid ratio (typically 1:50 to 1:200 w/w)

• Choose gentle detergent removal methods:

  • Dialysis (slow removal preserving delicate structures)

  • Bio-Beads or Amberlite adsorption (controlled rate of detergent removal)

  • Dilution below critical micelle concentration (for detergent-stable proteins)

• Verify reconstitution efficiency through:

  • Freeze-fracture electron microscopy

  • Sucrose density gradient centrifugation

  • Dynamic light scattering for size distribution

• Confirm protein orientation using protease protection assays or antibody accessibility tests

This approach has proven effective for membrane proteins similar to those described in study , where membrane protein fractions were successfully reconstituted into liposomes for functional studies.

Q: What membrane mimetics beyond liposomes should be considered?

A: Alternative membrane mimetics include:

• Nanodiscs: Provide a native-like bilayer environment with precise control over size and composition

• Amphipols: Amphipathic polymers that stabilize membrane proteins without conventional detergents

• Styrene-maleic acid lipid particles (SMALPs): Extract proteins with surrounding native lipids

• Bicelles: Disc-shaped mixed micelles combining long-chain and short-chain lipids

• Lipidic cubic phases: Three-dimensional lipid bilayer networks useful for both functional studies and crystallization

Each system offers distinct advantages for specific analytical techniques and should be selected based on experimental requirements.

How can expression yields be maximized?

Q: What strategies overcome common expression bottlenecks for this membrane protein?

A: To maximize expression yields of functional UPF0059 membrane protein:

• Optimize E. coli expression conditions :

  • Test multiple E. coli strains (BL21, C41/C43, Lemo21)

  • Evaluate induction conditions (temperature, inducer concentration, time)

  • Consider auto-induction media for gentler expression

• For yeast expression:

  • Test different promoters (constitutive vs. inducible)

  • Optimize carbon source and induction protocols

• For insect or mammalian expression when post-translational modifications are critical :

  • Optimize virus titer and infection time for baculovirus systems

  • Test different cell lines for highest expression

• For cell-free expression systems :

  • Optimize reaction components and conditions

  • Include appropriate membrane mimetics during translation

Each approach should be evaluated using small-scale expression trials before scaling up.

Q: What purification strategies maximize recovery of functional protein?

A: To optimize purification while maintaining function:

• Implement gentle solubilization conditions:

  • Screen multiple detergents (maltoside, glucoside, and fos-choline series)

  • Include stabilizers in extraction buffers (glycerol, specific lipids)

• Optimize affinity purification:

  • Use gradient elution to minimize protein denaturation

  • Control flow rates to ensure complete binding

• Consider purification under controlled redox conditions if the protein contains cysteine residues

• Implement buffer optimization:

  • Test various pH values around physiological range

  • Screen different salt concentrations

• Include quality control steps:

  • Size exclusion chromatography to verify monodispersity

  • Activity assays after each purification step

These strategies help maximize both yield and functional integrity of the purified protein.

What are effective analytical workflows for functional characterization?

Q: How should researchers design a comprehensive functional analysis pipeline?

A: A systematic functional characterization workflow should include:

• Initial bioinformatic analysis:

  • Sequence-based predictions of function

  • Structural modeling and comparative analysis

  • Genomic context examination

• Biochemical characterization:

  • Substrate binding assays

  • Transport activity measurements (if appropriate)

  • Cofactor requirements assessment

• Structural correlates:

  • Conformational changes upon substrate binding

  • Identification of functional domains

• Mutagenesis studies:

  • Alanine scanning of conserved residues

  • Specific mutations based on functional hypotheses

• In vivo validation:

  • Complementation of knockout phenotypes

  • Physiological response to expression modulation

This systematic approach ensures comprehensive functional insights while minimizing experimental artifacts.

How can solubility and stability issues be addressed?

Q: What solutions exist for poor solubility during membrane protein extraction?

A: To address solubility issues with UPF0059 membrane protein:

• Implement a systematic detergent screening approach:

  • Test different detergent classes (maltoside, glucoside, fos-choline)

  • Evaluate various detergent concentrations

  • Consider detergent mixtures for enhanced solubilization

• Optimize solubilization conditions:

  • Adjust buffer pH and ionic strength

  • Include stabilizing additives (glycerol, specific lipids)

  • Test different temperatures during solubilization

• Consider alternative solubilization approaches:

  • Styrene-maleic acid copolymers for native lipid co-extraction

  • Amphipathic polymers as detergent alternatives

  • Fluorinated surfactants for challenging membrane proteins

These approaches can significantly improve extraction efficiency while preserving protein structure and function.

Q: How can researchers prevent aggregation during purification and storage?

A: To minimize aggregation:

• Maintain appropriate detergent concentration above critical micelle concentration throughout all steps

• Include stabilizers in all buffers:

  • 50% glycerol or 6% trehalose as used in commercial preparations

  • Specific lipids that may stabilize the native structure

• Control temperature during purification (typically 4°C)

• Avoid extreme pH conditions

• Consider adding reducing agents if the protein contains cysteines

• Store in small aliquots at -20°C or -80°C to prevent repeated freeze-thaw cycles

• For working solutions, maintain at 4°C for no more than one week

How can researchers troubleshoot inactive protein preparations?

Q: What strategies help distinguish between denaturation and inhibition?

A: To determine whether inactivity results from denaturation or inhibition:

• Assess protein structural integrity:

  • Circular dichroism to evaluate secondary structure

  • Intrinsic fluorescence to monitor tertiary structure

  • Size exclusion chromatography to detect aggregation

• Evaluate possible inhibition mechanisms:

  • Test activity in different buffer compositions

  • Examine the effect of potential inhibitors from expression/purification

  • Include potential cofactors that might be required for activity

• Compare with positive controls:

  • Use commercially available preparations with verified activity

  • Test parallel preparations using different methods

• Implement recovery strategies:

  • Detergent exchange to remove potential inhibitors

  • Reconstitution into different lipid environments

  • Removal of affinity tags if they might interfere with function

This systematic approach helps identify the source of inactivity and guide corrective measures.

Q: How can researchers verify that purified protein retains native conformation?

A: To confirm native conformation:

• Implement biophysical characterization:

  • Circular dichroism spectra typical of membrane proteins

  • Thermal denaturation profiles to assess stability

  • Limited proteolysis to examine domain structure

• Functional verification:

  • Ligand binding assays

  • Reconstitution-based functional tests

• Structural integrity assessment:

  • Analytical ultracentrifugation for oligomeric state

  • Native PAGE mobility

  • Negative-stain electron microscopy

What emerging technologies will advance UPF0059 membrane protein research?

Q: How might cryo-electron microscopy transform structural studies of this protein?

A: Cryo-electron microscopy (cryo-EM) offers significant potential for UPF0059 membrane protein structural studies:

• Single particle analysis can determine structures without crystallization

• Recent advances in direct electron detectors and image processing have enabled atomic-resolution structures of membrane proteins smaller than 100 kDa

• Various membrane mimetics (nanodiscs, amphipols) are compatible with cryo-EM

• Multiple conformational states can be captured in a single dataset

• Time-resolved cryo-EM could potentially visualize transport cycles if the protein functions as a manganese efflux pump

Implementing cryo-EM strategies could overcome the crystallization bottleneck that traditionally challenges membrane protein structural biology.

Q: What computational advances might accelerate functional annotation?

A: Emerging computational approaches include:

• Machine learning algorithms trained on membrane protein datasets to predict function

• Enhanced molecular dynamics simulations in explicit membrane environments

• Quantum mechanics/molecular mechanics (QM/MM) calculations for mechanism prediction

• Deep learning approaches for structure prediction (like AlphaFold2) specialized for membrane proteins

• Systems biology modeling to predict pathway involvement and physiological role

• Network analysis methods to identify functional associations

• Virtual screening against structural models to identify potential ligands or inhibitors

These computational techniques, especially when integrated with experimental validation, promise to accelerate functional annotation of this uncharacterized membrane protein.

How might understanding this protein impact biotechnology applications?

Q: What potential applications exist if the manganese transport function is confirmed?

A: If confirmed as a manganese efflux pump , potential applications include:

• Development of engineered bacteria with enhanced manganese tolerance for bioremediation

• Creation of biosensors for manganese detection in environmental or biological samples

• Design of antimicrobial agents targeting this Bacillus anthracis protein

• Biomedical applications related to manganese homeostasis disorders

• Industrial biotechnology applications requiring controlled metal ion concentrations

• Agricultural applications for crops grown in manganese-rich soils

Each application would require detailed understanding of transport mechanism, specificity, and regulation to enable effective engineering.