Recombinant UPF0059 membrane protein CE1598 (CE1598)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; CE1598; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Target Names
mntP
Target Protein Sequence
MPLVHVMLLSCGVAADAFACSIARGTAIRVNIIKRSLILAGIFGVFQALMPVIGWGIGYF FAELSFIRAIDHWVAFLLLAGVGAKMIWDAFHQDADVDVIDTGAVQLRPALILGLATSID ALAVGMGMAFVHAPIITLALAMGLTTFVLSLVGAWMGHHGGGRFGGWATVIGGLVLIGLG GNILFDHMLG
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0059 membrane protein CE1598 and what organism does it originate from?

UPF0059 membrane protein CE1598 is a membrane protein from Corynebacterium efficiens, identified by UniProt ID Q8FTH1. This protein is also annotated as "Putative manganese efflux pump MntP" with the gene name mntP . It belongs to the UPF0059 family of membrane proteins, which are typically involved in metal ion transport across bacterial membranes. The protein is predicted to contain multiple transmembrane domains, consistent with its putative function in manganese efflux. As a bacterial membrane protein, CE1598 represents an important component of metal homeostasis systems in C. efficiens.

Expression Systems and Strategies

For expression of UPF0059 membrane protein CE1598 in insect cells, the following protocol is recommended based on established methodologies for membrane proteins:

  • Clone preparation:

    • Clone the CE1598 gene into a suitable baculovirus transfer vector (e.g., pOET vector)

    • Include appropriate purification tags (e.g., N-terminal His-tag as used in E. coli expression)

  • Baculovirus generation:

    • Transfect Sf9 cells (0.4 × 10^6 cells/mL) in a 6-well plate with:

      • 100 μL Grace's unsupplemented medium

      • 5 μL flashBAC™ virus DNA

      • 500 ng pOET-CE1598 plasmid

      • 1.2 μL baculoFECTIN II transfection reagent

    • Incubate at 27-28°C overnight

    • Harvest P0 virus after 5 days and amplify to generate high-titer P1 virus stock

  • Expression optimization:

    • Conduct small-scale tests (6-well plates) with different virus volumes and harvest times (48-72 hours)

    • Analyze expression by Western blotting to identify optimal conditions

  • Large-scale expression:

    • Dilute Sf9 cells to 0.7 × 10^6 cells/mL in 2L shaker flasks

    • Allow to grow to approximately 1 × 10^6 cells/mL

    • Add virus at MOI 5-10

    • Incubate at 27-28°C with shaking at 100 rpm for 2-3 days

  • Membrane preparation:

    • Harvest cells by centrifugation (7,000 × g, 10 minutes, 4°C)

    • Resuspend in PBS and recentrifuge

    • Homogenize in buffer with protease inhibitors

    • Disrupt cells using nitrogen pressure (500 PSI)

    • Remove cell debris by low-speed centrifugation (750 × g)

    • Collect membranes by ultracentrifugation (100,000 × g)

This protocol has been successful for the expression of numerous membrane proteins in insect cells and can be adapted specifically for UPF0059 membrane protein CE1598.

What are the critical factors for successful purification of UPF0059 membrane protein CE1598?

Successful purification of UPF0059 membrane protein CE1598 depends on several critical factors:

  • Effective membrane preparation:

    • Complete cell lysis using appropriate disruption methods

    • Proper separation of membranes from cellular debris

    • Collection of membrane fractions by ultracentrifugation

  • Optimal solubilization conditions:

    • Selection of appropriate detergents that maintain protein structure and function

    • Determination of optimal detergent-to-protein ratios

    • Inclusion of stabilizers such as glycerol in solubilization buffers

  • Affinity purification strategy:

    • Utilization of N-terminal His-tag for immobilized metal affinity chromatography (IMAC)

    • Careful optimization of imidazole concentrations in wash and elution buffers

    • Inclusion of detergent above critical micelle concentration in all purification buffers

  • Protein stabilization during purification:

    • Maintenance of low temperature (4°C) throughout the purification process

    • Addition of protease inhibitors to prevent degradation

    • Inclusion of stabilizing components such as trehalose (6%) as indicated in storage buffer recommendations

  • Storage and handling considerations:

    • Storage at -20°C/-80°C for long-term preservation

    • Addition of 50% glycerol as a cryoprotectant for frozen storage

    • Avoidance of repeated freeze-thaw cycles

    • Storage of working aliquots at 4°C for up to one week

  • Quality control:

    • Assessment of purity by SDS-PAGE (>90% purity target)

    • Verification of protein identity by mass spectrometry or Western blotting

    • Evaluation of homogeneity by size exclusion chromatography

By carefully optimizing these factors, researchers can obtain pure, stable, and functional UPF0059 membrane protein CE1598 suitable for downstream structural and functional studies.

What methods can be used to assess the manganese transport activity of UPF0059 membrane protein CE1598?

As a putative manganese efflux pump (MntP) , several complementary methods can be used to assess the transport activity of UPF0059 membrane protein CE1598:

  • Reconstitution-based transport assays:

    • Reconstitute purified CE1598 into proteoliposomes with controlled lipid composition

    • Pre-load liposomes with manganese or other divalent metals

    • Measure efflux using:
      a) Radioactive tracers (e.g., 54Mn)
      b) Metal-sensitive fluorescent probes
      c) Atomic absorption spectroscopy to quantify metal content

  • Whole-cell manganese sensitivity assays:

    • Express CE1598 in heterologous systems (E. coli, yeast)

    • Assess growth in presence of varying manganese concentrations

    • Compare wild-type protein with site-directed mutants to identify key functional residues

  • Metal binding studies:

    • Isothermal titration calorimetry (ITC) to measure direct binding of manganese

    • Microscale thermophoresis (MST) to detect conformational changes upon metal binding

    • Equilibrium dialysis with inductively coupled plasma mass spectrometry (ICP-MS) detection

  • Electrophysiological approaches:

    • Reconstitute CE1598 in planar lipid bilayers

    • Measure ion conductance using patch-clamp techniques

    • Characterize ion selectivity by testing multiple metal ions

  • Fluorescence-based conformational change assays:

    • Introduce fluorescent labels at strategic positions

    • Monitor transport-associated conformational changes in real-time

    • Correlate structural dynamics with transport activity

Each method provides unique insights into different aspects of transport activity, from metal binding specificity to transport kinetics and energetics. Combining multiple approaches provides the most comprehensive functional characterization.

How can I determine if UPF0059 membrane protein CE1598 is properly folded after purification?

Assessing the proper folding of UPF0059 membrane protein CE1598 after purification is crucial for functional and structural studies. Several complementary techniques can be employed:

  • Spectroscopic techniques:

    • Circular Dichroism (CD) spectroscopy to analyze secondary structure content

    • Intrinsic tryptophan fluorescence to assess tertiary structure

    • Fourier-transform infrared spectroscopy (FTIR) for membrane proteins in lipid environments

  • Size and homogeneity analysis:

    • Size exclusion chromatography to evaluate monodispersity and oligomeric state

    • Dynamic light scattering (DLS) to assess size distribution and aggregation state

    • Native gel electrophoresis to examine oligomeric states

  • Thermal stability assays:

    • Differential scanning fluorimetry with membrane protein-compatible dyes

    • Thermal denaturation monitored by CD spectroscopy

    • Nanoscale differential scanning calorimetry (nanoDSC)

  • Ligand binding assays:

    • Testing binding of known substrates (manganese ions) using ITC or MST

    • Evaluating specific inhibitor binding as a proxy for proper folding

    • Fluorescent ligand binding assays if applicable

  • Limited proteolysis:

    • Controlled digestion with proteases to assess structural compactness

    • Comparison of digestion patterns between putative functional and non-functional preparations

    • Mass spectrometry analysis of proteolytic fragments

  • Functional assays:

    • Transport activity measurements in reconstituted systems

    • Metal binding assays

    • ATPase activity (if the protein has associated ATPase domains)

Properly folded membrane proteins typically display characteristic secondary structure profiles (often high α-helical content for multi-spanning membrane proteins), monodisperse behavior in solution, resistance to proteolytic degradation, and specific ligand binding and functional activities.

What are the recommended methods for reconstituting UPF0059 membrane protein CE1598 into liposomes for functional studies?

Reconstitution of UPF0059 membrane protein CE1598 into liposomes is essential for functional transport studies. The following protocol is recommended based on established methods for membrane transporters:

  • Lipid preparation:

    • Select appropriate lipids (E. coli total lipid extract or defined mixtures like POPC:POPE:POPG at 7:2:1 ratio)

    • Dissolve lipids in chloroform, dry under nitrogen gas, and remove residual solvent under vacuum

    • Hydrate lipids in reconstitution buffer to 10-20 mg/mL concentration

    • Subject to freeze-thaw cycles (5-10 times) followed by extrusion through 400 nm filters

  • Protein-to-lipid ratio optimization:

    • Test multiple protein-to-lipid ratios (typically 1:50 to 1:500 w/w)

    • For initial screens, prepare small-scale reconstitutions with varying ratios

  • Detergent-mediated reconstitution:

    • Add detergent (e.g., Triton X-100) to preformed liposomes to destabilize them

    • Mix solubilized purified CE1598 with destabilized liposomes

    • Remove detergent by one of these methods:
      a) Bio-Beads SM-2 adsorbent (staged addition over 24 hours at 4°C)
      b) Dialysis against detergent-free buffer (48-72 hours with buffer changes)
      c) Cyclodextrin-mediated detergent removal

  • Proteoliposome characterization:

    • Assess protein incorporation by SDS-PAGE of recovered proteoliposomes

    • Determine orientation using protease protection assays

    • Measure size distribution by dynamic light scattering or negative-stain electron microscopy

    • Verify membrane integrity using calcein leakage assays

  • Functional validation:

    • Prepare proteoliposomes loaded with appropriate metal indicators or buffers

    • Initiate transport by establishing ion gradients or addition of external substrate

    • Monitor transport using appropriate detection methods (fluorescence, radioactivity)

This methodological approach ensures the generation of functionally reconstituted UPF0059 membrane protein CE1598 in liposomes, providing a platform for detailed characterization of its transport properties.

How can molecular dynamics simulations contribute to understanding the mechanism of UPF0059 membrane protein CE1598?

Molecular dynamics (MD) simulations offer powerful insights into the structure, dynamics, and mechanism of membrane proteins like UPF0059 membrane protein CE1598 that complement experimental approaches:

  • Structural refinement and validation:

    • Generate homology models based on related membrane transporters

    • Refine models through extended simulations in explicit membrane environments

    • Validate structural stability and identify key structural elements

  • Transport pathway identification:

    • Track water molecules and ions to identify potential manganese transport paths

    • Calculate pore dimensions and energetic barriers within the transport channel

    • Identify constriction sites and gates that control ion permeation

  • Conformational dynamics analysis:

    • Characterize conformational changes associated with transport cycles

    • Identify rigid domains versus flexible regions involved in protein function

    • Calculate free energy landscapes for different conformational states

  • Metal binding site characterization:

    • Predict manganese binding sites based on coordination geometry

    • Calculate binding affinities through free energy calculations

    • Compare selectivity for different metal ions (Mn2+, Fe2+, Zn2+, etc.)

  • Mutation effect prediction:

    • Simulate effects of point mutations on protein structure and function

    • Guide experimental mutagenesis by identifying critical residues

    • Explain experimental observations from a structural perspective

  • Lipid-protein interactions:

    • Identify specific lipid binding sites that might stabilize the protein

    • Characterize the influence of membrane composition on protein dynamics

    • Explore effects of membrane thickness, curvature, and lateral pressure

For UPF0059 membrane protein CE1598, MD simulations would be particularly valuable for predicting the metal binding sites, transport pathway, and conformational changes associated with manganese efflux, guiding subsequent experimental verification.

What approaches can be used to study the oligomeric state of UPF0059 membrane protein CE1598?

Determining the oligomeric state of UPF0059 membrane protein CE1598 is crucial for understanding its functional mechanism. Several complementary approaches can be employed:

  • Size-based methods:

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Analytical ultracentrifugation in detergent solutions

    • Native gel electrophoresis calibrated with membrane protein standards

    • Asymmetric flow field-flow fractionation (AF4)

  • Direct visualization techniques:

    • Negative-stain electron microscopy to assess particle size and shape

    • Single-particle cryo-electron microscopy for higher resolution information

    • Atomic force microscopy of reconstituted proteins in supported lipid bilayers

  • Cross-linking studies:

    • Chemical cross-linking with different length cross-linkers

    • Photo-crosslinking with genetically incorporated photo-reactive amino acids

    • Mass spectrometry analysis of cross-linked products

    • In vivo cross-linking to capture physiologically relevant interactions

  • Spectroscopic approaches:

    • Fluorescence resonance energy transfer (FRET) between labeled subunits

    • Double electron-electron resonance (DEER) spectroscopy with spin labels

    • Single-molecule fluorescence techniques to observe subunit stoichiometry

  • Functional unit determination:

    • Concentration-dependent activity assays to determine minimal functional unit

    • Co-expression of wild-type and inactive mutants to assess functional complementation

    • Single-molecule transport assays in liposomes or nanodiscs

When applying these methods to UPF0059 membrane protein CE1598, it's important to consider the potential effects of detergents, which can sometimes disrupt native oligomeric states. Validating results across multiple techniques and in different membrane-mimetic environments (detergents, nanodiscs, liposomes) provides the most reliable determination of the physiologically relevant oligomeric state.

How can crystallization of UPF0059 membrane protein CE1598 be approached for structural studies?

Crystallization of membrane proteins like UPF0059 membrane protein CE1598 presents significant challenges but can be approached systematically:

  • Protein engineering strategies:

    • Construct design optimization (remove flexible termini, consider fusion partners)

    • Introduction of surface mutations to enhance crystal contacts

    • Insertion of crystallization chaperones (e.g., T4 lysozyme, BRIL, Fab fragments)

    • Creation of thermostabilized variants through directed evolution or computational design

  • Detergent and lipid screening:

    • Test multiple detergent classes (maltoside, glucoside, neopentyl glycol, steroid-based)

    • Screen detergent combinations and mixed micelles

    • Include specific lipids that may stabilize the protein

    • Explore amphipols or nanodiscs for crystallization

  • Crystallization methods:

    • Traditional vapor diffusion (hanging and sitting drop)

    • Lipidic cubic phase (LCP) crystallization, particularly effective for membrane proteins

    • Bicelle-based crystallization

    • Microfluidic approaches for miniaturized screening

  • Crystallization optimization matrix:

ParameterVariables to Screen
Temperature4°C, 18°C, 25°C
Protein concentration5-15 mg/mL
PrecipitantsPEGs, salts, alcohols
pH4.0-9.0
AdditivesDivalent metals, small molecules, ligands
Crystallization methodVapor diffusion, LCP, bicelles
  • Crystal optimization:

    • Seeding techniques (micro- and macro-seeding)

    • Additive screening (metals, small molecules, detergents)

    • Dehydration protocols

    • Post-crystallization treatments

  • Alternative approaches if crystallization proves challenging:

    • Single-particle cryo-electron microscopy

    • Micro-electron diffraction (microED) for small crystals

    • Nuclear magnetic resonance for specific domains or fragments

For UPF0059 membrane protein CE1598, including putative substrates like manganese in crystallization trials may stabilize specific conformations and enhance crystal formation by reducing conformational heterogeneity.

What solutions exist for addressing protein degradation during purification of UPF0059 membrane protein CE1598?

Protein degradation during purification of UPF0059 membrane protein CE1598 can significantly impact yield and quality. Several strategies can address this challenge:

  • Comprehensive protease inhibition:

    • Include multiple protease inhibitors in all buffers (PMSF, EDTA, Pepstatin A, Leupeptin)

    • Use commercial protease inhibitor cocktails optimized for membrane proteins

    • Add additional inhibitors specific to bacterial proteases if purifying from E. coli

  • Temperature management:

    • Maintain strict temperature control (4°C) throughout all purification steps

    • Minimize processing time to reduce exposure to proteases

    • Avoid freeze-thaw cycles, as specifically noted in storage recommendations

  • Buffer optimization:

    • Screen different pH conditions to identify optimal stability

    • Include stabilizing agents like glycerol (50% for storage)

    • Add specific metal ions that may stabilize the protein structure

  • Purification strategy modifications:

    • Implement more rapid purification protocols to minimize time

    • Consider on-column digestion of fusion tags rather than post-purification cleavage

    • Optimize elution conditions to minimize protein stress

  • Expression system adjustments:

    • Use protease-deficient host strains (e.g., BL21(DE3) pLysS for E. coli)

    • Consider alternative expression systems if specific proteases are problematic

    • Co-express chaperones to promote proper folding and reduce degradation susceptibility

  • Detect and characterize degradation:

    • Monitor purification fractions by SDS-PAGE and Western blotting

    • Identify degradation products by mass spectrometry

    • Map degradation sites to design more stable constructs

For UPF0059 membrane protein CE1598, the recommended storage buffer including Tris/PBS-based buffer with 6% trehalose at pH 8.0 provides a starting point, which can be further optimized based on experimental observations of stability and degradation patterns.

How can I troubleshoot poor solubilization of UPF0059 membrane protein CE1598 from membrane preparations?

Poor solubilization is a common challenge when working with membrane proteins like UPF0059 membrane protein CE1598. The following troubleshooting approaches can improve extraction efficiency:

  • Detergent optimization:

    • Screen a wider range of detergents with different properties:

      • Maltosides (DDM, UDM, DM) - generally mild and widely used

      • Glucosides (OG, NG) - more harsh but effective for some proteins

      • Neopentyl glycols (LMNG, DMNG) - enhanced stability for many membrane proteins

      • Zwitterionic detergents (LDAO, FC-12) - often effective but potentially denaturing

    • Test detergent mixtures (e.g., DDM/CHS, LMNG/CHS) which can enhance extraction

    • Optimize detergent concentration (typically 1-2% for solubilization, higher than CMC)

  • Solubilization conditions:

    • Vary buffer composition (ionic strength, pH, buffer type)

    • Optimize solubilization time (1-24 hours) and temperature (4°C vs. room temperature)

    • Adjust membrane-to-detergent ratio to ensure sufficient detergent

    • Consider adding specific lipids that may enhance solubilization

  • Membrane preparation quality:

    • Ensure membranes are properly prepared and not overly aggregated

    • If using E. coli, optimize membrane isolation protocol to enrich for CE1598-containing membranes

    • Resuspend membrane pellets thoroughly before adding solubilization buffer

  • Alternative solubilization strategies:

    • Try novel extraction methods like styrene maleic acid lipid particles (SMALPs)

    • Test native nanodiscs formation during extraction

    • Consider harsher conditions if milder approaches fail (include care to assess functional impact)

  • Enhancing protein stability during solubilization:

    • Add glycerol (10-20%) to solubilization buffer

    • Include specific substrates or ligands that might stabilize the protein

    • Consider adding specific metal ions (e.g., manganese) that may stabilize the protein

  • Monitoring solubilization efficiency:

    • Quantify protein in soluble and insoluble fractions after extraction

    • Use Western blotting to specifically track CE1598

    • Assess functional activity of solubilized material if possible

By systematically optimizing these parameters, researchers can significantly improve the solubilization efficiency of UPF0059 membrane protein CE1598, maximizing yield for downstream applications.

What strategies can address poor expression yields of UPF0059 membrane protein CE1598?

Addressing poor expression yields of UPF0059 membrane protein CE1598 requires a systematic optimization approach:

  • Expression vector optimization:

    • Test different promoter strengths (T7, tac, araBAD)

    • Optimize the ribosome binding site for efficient translation

    • Include appropriate secretion signals or membrane targeting sequences

    • Try different fusion partners (MBP, SUMO, Mistic) known to enhance membrane protein expression

  • Host strain selection:

    • For E. coli expression, test specialized strains like C41(DE3), C43(DE3), or Lemo21(DE3)

    • For insect cell expression, compare Sf9 and High Five™ cells

    • Consider the codon usage of the expression host relative to the CE1598 sequence

  • Expression conditions optimization matrix:

ParameterVariables to Test
Temperature16°C, 25°C, 30°C, 37°C
Induction timingEarly-log, mid-log, late-log phase
Inducer concentrationIPTG: 0.1-1.0 mM; Arabinose: 0.002-0.2%
Media compositionLB, TB, 2×YT, auto-induction media
AdditivesGlycerol, specific metal ions, osmolytes
Duration4h, 8h, overnight, 24h, 48h
  • Growth protocols for insect cell expression:

    • Optimize MOI (multiplicity of infection) for baculovirus infection (test MOI 5-10)

    • Determine optimal harvest time (48-72 hours post-infection)

    • Fine-tune cell density at infection (0.8-2.0 × 10^6 cells/mL)

    • Consider co-expression of chaperones or stabilizing factors

  • Reducing toxicity:

    • Use tightly controlled expression systems to prevent leaky expression

    • Balance expression levels to prevent overwhelming the membrane insertion machinery

    • Consider auto-induction systems for gradual protein production

  • Detection and quantification:

    • Implement sensitive Western blot detection to accurately quantify low expression levels

    • Use GFP fusions to monitor expression and localization in real-time

    • Develop small-scale membrane preparation protocols for rapid screening

For UPF0059 membrane protein CE1598, the documented successful expression in E. coli with an N-terminal His tag provides a starting point, but systematically exploring these parameters can significantly improve yields for structural and functional studies.

How can UPF0059 membrane protein CE1598 be utilized in studies of bacterial metal homeostasis?

UPF0059 membrane protein CE1598, annotated as a putative manganese efflux pump MntP , offers several research applications for studying bacterial metal homeostasis:

By serving as a model system for membrane metal transporters, UPF0059 membrane protein CE1598 can contribute significantly to our understanding of the fundamental mechanisms by which bacteria maintain appropriate intracellular metal concentrations, a critical aspect of bacterial physiology and pathogenesis.

What are the potential applications of structural information on UPF0059 membrane protein CE1598?

Structural information on UPF0059 membrane protein CE1598 would have numerous valuable applications:

  • Mechanism elucidation:

    • Identify metal binding sites and their coordination geometry

    • Reveal conformational changes associated with transport cycles

    • Determine the structural basis of ion selectivity and transport kinetics

  • Structure-guided drug design:

    • Enable rational design of inhibitors targeting specific structural features

    • Identify allosteric sites that could modulate transporter function

    • Support development of antimicrobials targeting metal homeostasis

  • Protein engineering applications:

    • Guide design of variants with altered selectivity or enhanced activity

    • Identify stabilizing mutations for improved expression and handling

    • Develop chimeric transporters with novel properties

  • Comparative structural biology:

    • Provide a structural template for modeling homologous transporters

    • Reveal conserved structural features across the UPF0059 family

    • Identify species-specific adaptations in transport mechanisms

  • Integration with functional data:

    • Interpret existing biochemical and genetic data in a structural context

    • Design focused functional studies based on structural insights

    • Correlate sequence variations with structural and functional differences

  • Teaching and communication:

    • Illustrate principles of membrane transport mechanisms

    • Demonstrate the relationship between protein structure and function

    • Visualize the molecular basis of metal homeostasis

High-resolution structural information would represent a significant advancement in understanding this protein family, providing a framework for interpreting functional data and guiding future research directions in bacterial metal transport and homeostasis.

How might UPF0059 membrane protein CE1598 be utilized in synthetic biology applications?

UPF0059 membrane protein CE1598, as a putative manganese efflux pump , offers several promising applications in synthetic biology:

  • Engineered metal homeostasis systems:

    • Develop bacteria with enhanced manganese tolerance for bioremediation

    • Create strains with precisely controlled intracellular metal concentrations

    • Engineer microbes capable of sequestering specific metals from the environment

  • Biosensor development:

    • Create whole-cell biosensors for environmental manganese detection

    • Develop protein-based sensors coupling metal binding to detectable signals

    • Engineer reporter systems responsive to metal transport activity

  • Synthetic cellular circuits:

    • Integrate metal-responsive elements with CE1598 expression

    • Create oscillatory systems based on metal transport dynamics

    • Design cellular logic gates using metal concentrations as inputs

  • Protein engineering platforms:

    • Use CE1598 as a scaffold for engineering novel transport specificities

    • Create chimeric transporters with altered selectivity or regulation

    • Develop switchable transporters controlled by external stimuli

  • Production of metal-dependent compounds:

    • Engineer pathways requiring precise metal concentrations

    • Balance metal availability for optimal enzymatic activity

    • Create compartmentalized systems with controlled metal environments

  • Synthetic minimal cell applications:

    • Include as a component in minimal cells requiring metal homeostasis

    • Study the minimal requirements for functional metal transport systems

    • Develop orthogonal metal homeostasis systems for synthetic cells

The modular nature of membrane transporters makes CE1598 particularly suitable for synthetic biology applications. By understanding its structure-function relationships and regulatory mechanisms, researchers can repurpose this protein as a building block for novel synthetic systems with applications ranging from environmental remediation to biosensing and cellular engineering.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.