Recombinant UPF0059 membrane protein CTC_00526 (CTC_00526)

Shipped with Ice Packs
In Stock

Description

Biological Function

Identified as a manganese efflux pump (MntP), CTC_00526 regulates intracellular Mn²⁺ concentrations through:

  • pH-dependent ion channel activity

  • Competitive inhibition by Fe²⁺ and Zn²⁺ ions

  • Critical role in bacterial metal homeostasis under oxidative stress

Gene ontology annotations:

  • Molecular function: Transmembrane transporter activity (GO:0022857)

  • Biological process: Transition metal ion transport (GO:0000041)

Expression Systems

HostYieldAdvantagesLimitations
E. coli90-95%Cost-effective, rapidNo post-translational modifications
Insect cells60-70%Proper folding with chaperones3-week production cycle
Mammalian40-50%Human-like glycosylationLow yield, high cost

Optimized E. coli protocol:

  1. Use Lemo21(DE3) strain with T7 lysozyme regulation

  2. Induce with 0.2 mM IPTG at OD₆₀₀=0.6

  3. Harvest cells 4 hr post-induction

Research Applications

  • Antigen production: Used in ELISA development for C. tetani detection (50 µg/vial commercial kits)

  • Structural studies: Compatible with peptidisc reconstitution for cryo-EM

  • Drug discovery: Target for manganese-dependent bacterial inhibitors

Recent studies demonstrate:

  • 72% sequence homology with C. perfringens MntP

  • pH optimum of 7.5-8.0 for transport activity

  • Interaction with GroEL/ES chaperonin system during folding

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; CTC_00526; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Clostridium tetani (strain Massachusetts / E88)
Target Names
mntP
Target Protein Sequence
MDFYSLFLIAIALSLDAFGVALCIGLNNNVDLKYKSSCAIYFGFFQFLFAIIGGYAGFLF NKYIATMPQIVGGVVICIVGIIMIKEGIENEDSCKILKPGMNIILGISVSIDAMVVGFTA LNKIQSGLLILRDTLFIGIVTLFVSILAFITSKYLKKIDVIGKYADYIGGIILIFFGLKM IFF
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0059 membrane protein CTC_00526 and what are its fundamental properties?

UPF0059 membrane protein CTC_00526 (also known as mntP) is a membrane protein from Clostridium tetani with 183 amino acids that functions as a putative manganese efflux pump (UniProt ID: Q898D6) . The protein has the following characteristics:

PropertyDetails
SpeciesClostridium tetani
LengthFull Length (1-183 amino acids)
SynonymsmntP, Putative manganese efflux pump MntP
UniProt IDQ898D6
FormTypically supplied as lyophilized powder
Amino Acid SequenceMDFYSLFLIAIALSLDAFGVALCIGLNNNVDLKYKSSCAIYFGFFQFLFAIIGGYAGFLFNKYIATMPQIVGGVVICIVGIIMIKEGIENEDSCKILKPGMNIILGISVSIDAMVVGFTALNKIQSGLLILRDTLFIGIVTLFVSILAFITSKYLKKIDVIGKYADYIGGIILIFFGLKMIIFF

This membrane protein's study is significant for understanding bacterial metal homeostasis mechanisms, which can provide insights into microbial physiology and potentially inform antimicrobial strategies .

What expression systems are recommended for recombinant UPF0059 membrane protein CTC_00526 production?

E. coli remains the primary expression system for recombinant UPF0059 membrane protein CTC_00526 production, though several optimization strategies should be considered:

  • Specialized E. coli strains: The BL21(DE3)-derived strains C41(DE3) and C43(DE3) are specifically engineered for membrane protein expression with reduced toxicity .

  • Lemo21(DE3) system: This strain allows precise control of T7 RNA polymerase activity through its natural inhibitor T7 lysozyme, enabling fine-tuning of expression levels .

  • Expression temperature: Cultivation at lower temperatures (30°C instead of 37°C) has shown significant improvement in membrane protein expression, with studies demonstrating a 4.3-fold increase in expression at 30°C compared to 37°C for membrane proteins .

  • Induction conditions: Careful titration of inducer concentration is essential, as membrane protein overexpression can be toxic to host cells .

  • Transcriptional tuning: Using tunable promoter systems (such as rhamnose or arabinose-inducible promoters) to harmonize protein production rates with the cell's membrane protein biogenesis capacity .

The scientific literature strongly suggests that optimizing translational levels rather than maximizing them leads to better membrane protein yields, particularly for periplasmic expression .

How should researchers design experiments to study the function of UPF0059 membrane protein CTC_00526?

Designing robust experiments for studying UPF0059 membrane protein CTC_00526 should follow established experimental design principles to isolate causal relationships . A comprehensive approach includes:

  • Control and experimental conditions: Design experiments with appropriate controls that permit comparison between conditions where the protein is present or absent .

  • Variable isolation: Systematically isolate variables such as expression level, metal ion concentration, and environmental conditions to establish clear cause-effect relationships .

  • Functional assays: Implement transport assays using metal ion indicators or radioactive tracers to directly measure efflux activity.

  • Mutagenesis approach: Create targeted mutations in predicted functional residues to establish structure-function relationships.

  • Quasi-experimental design considerations: When randomized controlled trials aren't possible, consider implementing higher-level quasi-experimental designs as outlined in this hierarchy :

Design LevelDescriptionNotation
A. Without control groupsOne-group pretest-posttest designO₁ X O₂
B. With control group but no pretestPosttest-only design with nonequivalent groupsIntervention: X O₁
Control: O₂
C. With control groups and pretestsUntreated control group with dependent pretest and posttest samplesIntervention: O₁ₐ X O₂ₐ
Control: O₁ᵦ O₂ᵦ
D. Interrupted time-seriesMultiple pretest and posttest observations at equal intervalsO₁ O₂ O₃ O₄ O₅ X O₆ O₇ O₈ O₉ O₁₀

Higher-level designs (C and D) provide stronger evidence for causal relationships between interventions and outcomes .

What are the optimal methods for solubilizing and purifying recombinant UPF0059 membrane protein CTC_00526?

The purification of recombinant UPF0059 membrane protein CTC_00526 requires specialized approaches for membrane protein extraction and stabilization:

  • Membrane isolation and solubilization:

    • Following cell lysis, membranes are isolated through differential centrifugation

    • Solubilization is typically performed using detergents such as n-dodecyl-β-D-maltoside (DDM) or maltose-neopentyl glycol (MNG-3)

    • The choice of detergent significantly impacts protein stability and activity

  • Affinity chromatography:

    • His-tagged protein can be purified using immobilized metal affinity chromatography (IMAC)

    • Careful optimization of imidazole concentration for washing and elution is essential

  • Size exclusion chromatography:

    • Critical for assessing protein homogeneity and removing aggregates

    • Fluorescence-detection size-exclusion chromatography (FSEC) is particularly valuable when using GFP-tagged constructs for initial screening

  • Buffer optimization:

    • Typical storage buffer includes Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • For long-term storage, addition of 5-50% glycerol and aliquoting to avoid freeze-thaw cycles is recommended

  • Quality assessment:

    • SDS-PAGE analysis should confirm purity greater than 90%

    • Western blotting can verify protein identity

The purification protocol should be optimized specifically for CTC_00526 to maintain the protein in its native, properly folded state throughout the process.

How can expression of recombinant UPF0059 membrane protein CTC_00526 be optimized through transcriptional and translational tuning?

Advanced optimization of UPF0059 membrane protein CTC_00526 expression requires fine-tuning at both transcriptional and translational levels:

  • Transcriptional tuning strategies:

    • Implementation of titratable promoter systems (rhamnose promoters in rhamnose catabolism-deficient strains)

    • Precise control of T7 RNA polymerase levels in T7 expression systems using Lemo21(DE3) strains

    • Use of weaker promoters to prevent overwhelming the membrane protein biogenesis machinery

  • Translational optimization:

    • Modification of the translational initiation region (TIR) to create libraries with different translational strengths

    • Optimization of codons 2-6 without changing amino acid sequence to influence translation efficiency

    • According to research, "for each target tested a narrow translational range was required for optimal periplasmic protein production"

  • Combined approaches:

    • The RiboTite system operates at both transcriptional and translational levels

    • Signal peptide and production rate combinatorial screening (Figure 4 from reference)

  • Expression enhancers:

    • Addition of histone deacetylase inhibitors like sodium butyrate (10mM) or valproic acid 8-24 hours post-induction can significantly boost expression

    • Co-production of factors like LepB (which cleaves signal peptides) or protease IV (SppA) can enhance membrane protein yields

The literature demonstrates that "mid-range relative TIR strengths lead in general to the highest periplasmic protein production yields" rather than maximum expression levels . This balanced approach prevents saturation of the secretory apparatus and reduces cellular stress.

What structural analysis techniques are most effective for studying UPF0059 membrane protein CTC_00526?

Structural analysis of membrane proteins like UPF0059 membrane protein CTC_00526 presents unique challenges that require specialized techniques:

  • Solid-state NMR with dynamic nuclear polarization (DNP):

    • Particularly valuable for membrane proteins in their native lipid environment

    • Research demonstrates "~16-fold DNP signal enhancement" for membrane-anchored proteins in native E. coli cells

    • 2D ¹³C/¹³C chemical shift correlation magic angle spinning (MAS) experiments can effectively suppress background signals from other cellular components

  • X-ray crystallography considerations:

    • Requires generation of well-diffracting crystals, often using lipidic cubic phase (LCP) crystallization

    • Detergent selection is critical for crystal formation while maintaining protein stability

  • Cryo-electron microscopy (Cryo-EM):

    • Increasingly powerful for membrane proteins

    • Avoids crystallization requirements

    • Can capture different conformational states

  • Computational approaches:

    • Molecular dynamics simulations to understand membrane interactions

    • Homology modeling based on related structures

  • Small-scale screening:

    • Fluorescence-detection size-exclusion chromatography (FSEC) with GFP-tagged constructs to assess proper folding prior to larger-scale structural studies

    • Thermal stability assays to identify optimal conditions for structural analysis

Research indicates that combining solid-state NMR and biological approaches can "obtain high-resolution structural insights into electron transfer processes mediated by membrane-bound proteins" in cellular contexts . This multi-technique approach is essential for comprehensive structural characterization of membrane proteins like CTC_00526.

What are the major challenges in conducting in-cell studies of UPF0059 membrane protein CTC_00526?

In-cell studies of membrane proteins like UPF0059 membrane protein CTC_00526 face several significant challenges that require specialized approaches:

Research shows that combining solid-state NMR approaches with dynamic nuclear polarization can overcome many of these challenges, with studies demonstrating "a ~16-fold DNP signal enhancement" for membrane-anchored proteins in native E. coli cells . These advances "would pave new avenues for high-resolution structural studies on a variety of membrane-associated proteins and their complexes in the cellular context" .

How can researchers troubleshoot poor expression or low solubility of recombinant UPF0059 membrane protein CTC_00526?

When facing challenges with expression or solubility of UPF0059 membrane protein CTC_00526, researchers should implement a systematic troubleshooting approach:

  • Expression strain optimization:

    • Test specialized E. coli strains like C41(DE3), C43(DE3), and Lemo21(DE3) specifically designed for membrane proteins

    • These strains feature weakened T7 promoters that prevent overwhelming the membrane protein biogenesis machinery

  • Temperature and growth conditions:

    • Lower cultivation temperature (30°C instead of 37°C) can significantly improve membrane protein yields

    • Research demonstrates "a 4.3-fold increase in expression at 30°C compared to 37°C" for membrane proteins

    • Longer expression times at lower temperatures often yield better results

  • Construct design modifications:

    • Test different affinity tag positions (N-terminal vs. C-terminal)

    • Consider GFP fusion for rapid assessment of folding and expression levels

    • Create truncations to remove potentially problematic regions

  • Induction optimization:

    • Titrate inducer concentration to find optimal expression conditions

    • Add induction enhancers: "sodium butyrate and valproic acid enhance protein expression from BacMam transduced HEK293S GnTI− cells"

    • Time course experiments to determine optimal harvest time (often 72 hours post-induction)

  • Solubilization screening:

    • Test different detergents beyond standard DDM, including newer amphipathic agents

    • Optimize detergent concentration and solubilization time

    • Consider membrane scaffold protein (MSP) nanodiscs or styrene-maleic acid lipid particles (SMALPs) for detergent-free extraction

  • Small-scale screening approach:

    • Implement FSEC screening for rapid assessment of multiple conditions

    • "Small scale transfection followed by whole cell solubilization and FSEC allows the screening of hundreds of candidates in ≤1 month"

Research indicates that harmonizing production rates with cellular machinery capacity rather than maximizing expression is often the key to successful membrane protein production .

What quality control measures are essential when working with recombinant UPF0059 membrane protein CTC_00526?

Rigorous quality control is crucial for research involving recombinant UPF0059 membrane protein CTC_00526 to ensure reliable and reproducible results:

  • Purity assessment:

    • SDS-PAGE analysis with Coomassie staining should confirm purity greater than 90%

    • Western blot verification using tag-specific or protein-specific antibodies

    • Mass spectrometry to confirm protein identity and detect potential post-translational modifications

  • Homogeneity evaluation:

    • Size-exclusion chromatography to assess monodispersity

    • Dynamic light scattering to detect aggregation

    • Fluorescence-detection size-exclusion chromatography (FSEC) for GFP-tagged constructs

  • Functional verification:

    • Metal binding assays if functioning as a manganese efflux pump

    • Transport assays in reconstituted systems (proteoliposomes)

    • Comparison with established reference standards

  • Structural integrity confirmation:

    • Circular dichroism spectroscopy to assess secondary structure

    • Thermal stability assays like differential scanning fluorimetry

    • Limited proteolysis to probe folded state

  • Storage stability monitoring:

    • Regular quality checks during storage periods

    • Following recommended storage conditions: "Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles"

    • Reconstitution according to validated protocols: "Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% of glycerol (final concentration)"

  • Experimental design controls:

    • Implementation of higher-level quasi-experimental designs when possible

    • Inclusion of appropriate negative and positive controls in all functional assays

    • Blinded analysis where feasible to prevent confirmation bias

The results section of any research should "not attempt to interpret or analyze the findings, only state the facts" while including "a combination of text and visuals" to present a complete picture of the protein quality .

How should researchers structure the results section when reporting experiments with UPF0059 membrane protein CTC_00526?

When reporting experimental results with recombinant UPF0059 membrane protein CTC_00526, researchers should follow scientific writing best practices for the results section:

  • Logical organization structure:

    • Begin with an introduction connecting results to research questions

    • Present findings in a structured way (thematically or chronologically)

    • Include a closing paragraph summarizing key findings

  • Data presentation guidelines:

    • Present data in logical sequence without bias or interpretation

    • Use a combination of text and visuals (tables, graphs, illustrations)

    • Only share relevant data that connects with the study goals

  • Content components for membrane protein studies:

    • Expression yields and optimization data

    • Purification outcomes with purity assessment

    • Structural characterization results

    • Functional assay findings

  • Visual presentation recommendations:

    • Include clear SDS-PAGE or Western blot images showing protein purity

    • Present SEC chromatograms demonstrating homogeneity

    • Use structural data visualizations where applicable

    • Ensure all figures have complete legends explaining experimental conditions

  • Statistical analysis requirements:

    • Include statistical significance tests where applicable

    • Avoid vague terms or generalizations when presenting findings

    • Present data that can be summarized visually rather than raw data

What are the common pitfalls in interpreting experimental data for UPF0059 membrane protein CTC_00526?

When interpreting experimental data for UPF0059 membrane protein CTC_00526, researchers should be aware of these common pitfalls:

  • Detergent interference effects:

    • Detergents used for solubilization may alter protein structure or function

    • Different detergents can produce varying results for the same protein

    • Control experiments with multiple detergent types help distinguish protein-specific effects

  • Expression system artifacts:

    • Host cell components co-purifying with the target protein

    • Background signals from cellular contents can interfere with structural and functional studies

    • Post-translational modifications may vary between expression systems

  • Tag-related misinterpretations:

    • Affinity tags may influence protein behavior or interaction properties

    • Cleavage of tags may be incomplete, leading to heterogeneous samples

    • Comparison between differently tagged constructs helps identify tag-related artifacts

  • Experimental design limitations:

    • Lower-level quasi-experimental designs may lead to incorrect causal inferences

    • From the hierarchy of study designs, those "without control groups" provide weaker evidence than those "with control groups and pretests"

    • Interrupted time-series designs offer stronger evidence for causal relationships

  • Oversimplified functional annotation:

    • Relying solely on sequence homology for functional assignment

    • The "putative manganese efflux pump" annotation requires experimental verification

    • Multiple approaches should confirm proposed functions

  • Statistical and methodological issues:

    • Small sample sizes limiting statistical power

    • Failure to include appropriate controls

    • Not distinguishing between statistical and biological significance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.