Identified as a manganese efflux pump (MntP), CTC_00526 regulates intracellular Mn²⁺ concentrations through:
Gene ontology annotations:
Molecular function: Transmembrane transporter activity (GO:0022857)
Biological process: Transition metal ion transport (GO:0000041)
Induce with 0.2 mM IPTG at OD₆₀₀=0.6
Antigen production: Used in ELISA development for C. tetani detection (50 µg/vial commercial kits)
Structural studies: Compatible with peptidisc reconstitution for cryo-EM
Drug discovery: Target for manganese-dependent bacterial inhibitors
Recent studies demonstrate:
KEGG: ctc:CTC_00526
STRING: 212717.CTC00526
UPF0059 membrane protein CTC_00526 (also known as mntP) is a membrane protein from Clostridium tetani with 183 amino acids that functions as a putative manganese efflux pump (UniProt ID: Q898D6) . The protein has the following characteristics:
| Property | Details |
|---|---|
| Species | Clostridium tetani |
| Length | Full Length (1-183 amino acids) |
| Synonyms | mntP, Putative manganese efflux pump MntP |
| UniProt ID | Q898D6 |
| Form | Typically supplied as lyophilized powder |
| Amino Acid Sequence | MDFYSLFLIAIALSLDAFGVALCIGLNNNVDLKYKSSCAIYFGFFQFLFAIIGGYAGFLFNKYIATMPQIVGGVVICIVGIIMIKEGIENEDSCKILKPGMNIILGISVSIDAMVVGFTALNKIQSGLLILRDTLFIGIVTLFVSILAFITSKYLKKIDVIGKYADYIGGIILIFFGLKMIIFF |
This membrane protein's study is significant for understanding bacterial metal homeostasis mechanisms, which can provide insights into microbial physiology and potentially inform antimicrobial strategies .
E. coli remains the primary expression system for recombinant UPF0059 membrane protein CTC_00526 production, though several optimization strategies should be considered:
Specialized E. coli strains: The BL21(DE3)-derived strains C41(DE3) and C43(DE3) are specifically engineered for membrane protein expression with reduced toxicity .
Lemo21(DE3) system: This strain allows precise control of T7 RNA polymerase activity through its natural inhibitor T7 lysozyme, enabling fine-tuning of expression levels .
Expression temperature: Cultivation at lower temperatures (30°C instead of 37°C) has shown significant improvement in membrane protein expression, with studies demonstrating a 4.3-fold increase in expression at 30°C compared to 37°C for membrane proteins .
Induction conditions: Careful titration of inducer concentration is essential, as membrane protein overexpression can be toxic to host cells .
Transcriptional tuning: Using tunable promoter systems (such as rhamnose or arabinose-inducible promoters) to harmonize protein production rates with the cell's membrane protein biogenesis capacity .
The scientific literature strongly suggests that optimizing translational levels rather than maximizing them leads to better membrane protein yields, particularly for periplasmic expression .
Designing robust experiments for studying UPF0059 membrane protein CTC_00526 should follow established experimental design principles to isolate causal relationships . A comprehensive approach includes:
Control and experimental conditions: Design experiments with appropriate controls that permit comparison between conditions where the protein is present or absent .
Variable isolation: Systematically isolate variables such as expression level, metal ion concentration, and environmental conditions to establish clear cause-effect relationships .
Functional assays: Implement transport assays using metal ion indicators or radioactive tracers to directly measure efflux activity.
Mutagenesis approach: Create targeted mutations in predicted functional residues to establish structure-function relationships.
Quasi-experimental design considerations: When randomized controlled trials aren't possible, consider implementing higher-level quasi-experimental designs as outlined in this hierarchy :
| Design Level | Description | Notation |
|---|---|---|
| A. Without control groups | One-group pretest-posttest design | O₁ X O₂ |
| B. With control group but no pretest | Posttest-only design with nonequivalent groups | Intervention: X O₁ Control: O₂ |
| C. With control groups and pretests | Untreated control group with dependent pretest and posttest samples | Intervention: O₁ₐ X O₂ₐ Control: O₁ᵦ O₂ᵦ |
| D. Interrupted time-series | Multiple pretest and posttest observations at equal intervals | O₁ O₂ O₃ O₄ O₅ X O₆ O₇ O₈ O₉ O₁₀ |
Higher-level designs (C and D) provide stronger evidence for causal relationships between interventions and outcomes .
The purification of recombinant UPF0059 membrane protein CTC_00526 requires specialized approaches for membrane protein extraction and stabilization:
Membrane isolation and solubilization:
Affinity chromatography:
Size exclusion chromatography:
Buffer optimization:
Quality assessment:
The purification protocol should be optimized specifically for CTC_00526 to maintain the protein in its native, properly folded state throughout the process.
Advanced optimization of UPF0059 membrane protein CTC_00526 expression requires fine-tuning at both transcriptional and translational levels:
Transcriptional tuning strategies:
Translational optimization:
Modification of the translational initiation region (TIR) to create libraries with different translational strengths
Optimization of codons 2-6 without changing amino acid sequence to influence translation efficiency
According to research, "for each target tested a narrow translational range was required for optimal periplasmic protein production"
Combined approaches:
Expression enhancers:
The literature demonstrates that "mid-range relative TIR strengths lead in general to the highest periplasmic protein production yields" rather than maximum expression levels . This balanced approach prevents saturation of the secretory apparatus and reduces cellular stress.
Structural analysis of membrane proteins like UPF0059 membrane protein CTC_00526 presents unique challenges that require specialized techniques:
Solid-state NMR with dynamic nuclear polarization (DNP):
Particularly valuable for membrane proteins in their native lipid environment
Research demonstrates "~16-fold DNP signal enhancement" for membrane-anchored proteins in native E. coli cells
2D ¹³C/¹³C chemical shift correlation magic angle spinning (MAS) experiments can effectively suppress background signals from other cellular components
X-ray crystallography considerations:
Requires generation of well-diffracting crystals, often using lipidic cubic phase (LCP) crystallization
Detergent selection is critical for crystal formation while maintaining protein stability
Cryo-electron microscopy (Cryo-EM):
Increasingly powerful for membrane proteins
Avoids crystallization requirements
Can capture different conformational states
Computational approaches:
Molecular dynamics simulations to understand membrane interactions
Homology modeling based on related structures
Small-scale screening:
Research indicates that combining solid-state NMR and biological approaches can "obtain high-resolution structural insights into electron transfer processes mediated by membrane-bound proteins" in cellular contexts . This multi-technique approach is essential for comprehensive structural characterization of membrane proteins like CTC_00526.
In-cell studies of membrane proteins like UPF0059 membrane protein CTC_00526 face several significant challenges that require specialized approaches:
Research shows that combining solid-state NMR approaches with dynamic nuclear polarization can overcome many of these challenges, with studies demonstrating "a ~16-fold DNP signal enhancement" for membrane-anchored proteins in native E. coli cells . These advances "would pave new avenues for high-resolution structural studies on a variety of membrane-associated proteins and their complexes in the cellular context" .
When facing challenges with expression or solubility of UPF0059 membrane protein CTC_00526, researchers should implement a systematic troubleshooting approach:
Expression strain optimization:
Temperature and growth conditions:
Construct design modifications:
Test different affinity tag positions (N-terminal vs. C-terminal)
Consider GFP fusion for rapid assessment of folding and expression levels
Create truncations to remove potentially problematic regions
Induction optimization:
Solubilization screening:
Test different detergents beyond standard DDM, including newer amphipathic agents
Optimize detergent concentration and solubilization time
Consider membrane scaffold protein (MSP) nanodiscs or styrene-maleic acid lipid particles (SMALPs) for detergent-free extraction
Small-scale screening approach:
Research indicates that harmonizing production rates with cellular machinery capacity rather than maximizing expression is often the key to successful membrane protein production .
Rigorous quality control is crucial for research involving recombinant UPF0059 membrane protein CTC_00526 to ensure reliable and reproducible results:
Purity assessment:
Homogeneity evaluation:
Size-exclusion chromatography to assess monodispersity
Dynamic light scattering to detect aggregation
Fluorescence-detection size-exclusion chromatography (FSEC) for GFP-tagged constructs
Functional verification:
Metal binding assays if functioning as a manganese efflux pump
Transport assays in reconstituted systems (proteoliposomes)
Comparison with established reference standards
Structural integrity confirmation:
Circular dichroism spectroscopy to assess secondary structure
Thermal stability assays like differential scanning fluorimetry
Limited proteolysis to probe folded state
Storage stability monitoring:
Regular quality checks during storage periods
Following recommended storage conditions: "Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles"
Reconstitution according to validated protocols: "Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% of glycerol (final concentration)"
Experimental design controls:
The results section of any research should "not attempt to interpret or analyze the findings, only state the facts" while including "a combination of text and visuals" to present a complete picture of the protein quality .
When reporting experimental results with recombinant UPF0059 membrane protein CTC_00526, researchers should follow scientific writing best practices for the results section:
Logical organization structure:
Data presentation guidelines:
Content components for membrane protein studies:
Expression yields and optimization data
Purification outcomes with purity assessment
Structural characterization results
Functional assay findings
Visual presentation recommendations:
Include clear SDS-PAGE or Western blot images showing protein purity
Present SEC chromatograms demonstrating homogeneity
Use structural data visualizations where applicable
Ensure all figures have complete legends explaining experimental conditions
Statistical analysis requirements:
When interpreting experimental data for UPF0059 membrane protein CTC_00526, researchers should be aware of these common pitfalls:
Detergent interference effects:
Detergents used for solubilization may alter protein structure or function
Different detergents can produce varying results for the same protein
Control experiments with multiple detergent types help distinguish protein-specific effects
Expression system artifacts:
Tag-related misinterpretations:
Affinity tags may influence protein behavior or interaction properties
Cleavage of tags may be incomplete, leading to heterogeneous samples
Comparison between differently tagged constructs helps identify tag-related artifacts
Experimental design limitations:
Oversimplified functional annotation:
Relying solely on sequence homology for functional assignment
The "putative manganese efflux pump" annotation requires experimental verification
Multiple approaches should confirm proposed functions
Statistical and methodological issues:
Small sample sizes limiting statistical power
Failure to include appropriate controls
Not distinguishing between statistical and biological significance