Recombinant UPF0059 membrane protein WS0973 (WS0973)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Expression System:

  • Host: Escherichia coli (standard for recombinant protein production) .

  • Construct: Codon-optimized gene cloned into expression vectors for high-yield soluble or membrane-bound expression .

Purification Protocol:

  1. Affinity Chromatography: Nickel-NTA resin for His-tag purification .

  2. Buffer Composition: Tris-based buffer with 50% glycerol for stability .

  3. Purity: ≥85% as verified by SDS-PAGE .

Primary Uses:

  • Antigen Production: Utilized in ELISA and antibody development due to high immunogenicity .

  • Structural Studies: Membrane protein crystallization trials .

  • Functional Assays: Hypothesized roles in ion transport or stress response (based on homology to UPF0059 proteins in Psychrobacter and Clostridium) .

Comparative Analysis:

OrganismProtein NameFunction (Putative)Reference
Wolinella succinogenesWS0973Membrane integrity
Psychrobacter cryohalolentisPcryo_0007Manganese efflux (MntP1)
Clostridium botulinumCLI_0469, CBO0394Uncharacterized transport

Limitations and Future Directions

  • Functional Data Gap: No direct enzymatic or transport activity studies reported for WS0973 .

  • Research Opportunities:

    • Interactome Mapping: Identify binding partners via pull-down assays.

    • Cryo-EM Studies: Resolve 3D structure to infer mechanistic roles .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you require a specific format, please specify your preference when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize the development of the specified tag.
Synonyms
mntP1; WS0973; Putative manganese efflux pump MntP 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) (Vibrio succinogenes)
Target Names
mntP1
Target Protein Sequence
MIELLLLSLALSMDAFAVSLGLGARFGYNKRESLRPALSFGIFQGIMPLLGFFVGVTFIA FISAFDHYLAFGILALIGAKMIYEGLSQSEEERLDELSHRTLLILSIATSIDALAAGVSL HLIDVNVFLSCTIIAFTTFLLSYLGVLWGKRAGEQCKRGAEILGGVILIGIGSKILLEHL FF
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links

KEGG: wsu:WS0973

STRING: 273121.WS0973

Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0059 membrane protein WS0973 and what is its biological function?

UPF0059 membrane protein WS0973, identified by UniProt accession number Q7MRX1, is a membrane protein from the bacterium Wolinella succinogenes. According to current research, it likely functions as a manganese efflux pump (MntP1), playing a role in metal ion homeostasis . The protein belongs to the UPF0059 family, which consists of uncharacterized membrane proteins with similar structural properties across various bacterial species.

The biological function appears to involve the transport of manganese ions across cellular membranes, which is critical for maintaining appropriate intracellular manganese concentrations. Excess manganese can be toxic to cells, making efflux mechanisms essential for bacterial survival under certain environmental conditions .

What expression systems are recommended for producing recombinant WS0973?

Recombinant WS0973 can be expressed in several heterologous systems, each with distinct advantages depending on your experimental requirements:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid expressionMay form inclusion bodies; membrane protein folding challenges
YeastBetter for eukaryotic-like post-translational modificationsLonger expression time; lower yields than E. coli
BaculovirusSuperior for complex membrane proteins; near-native foldingTechnical complexity; higher cost; longer production time
Mammalian cellsMost native-like post-translational modificationsHighest cost; technical expertise required; lower yields

The selection of an appropriate expression system should be based on the specific research objectives. For structural studies requiring large protein quantities, E. coli may be preferable despite potential folding issues. For functional studies where proper folding is critical, insect or mammalian expression systems may yield better results despite their higher cost and complexity .

How should tag selection be approached for recombinant WS0973 production?

Tag selection is a critical consideration for recombinant WS0973 production. The protein typically contains an N-terminal tag and may also include a C-terminal tag, depending on the experimental requirements .

When selecting tags, consider:

  • Purpose of the experiment (purification, detection, or localization)

  • Impact on protein folding and function

  • Cleavability if native protein is required

  • Size and potential interference with structural studies

Common tags for membrane proteins include:

  • His6 tag: Small size, minimal interference with function

  • GST tag: Enhances solubility but may affect membrane integration

  • FLAG or HA tags: Useful for detection and immunoprecipitation studies

For WS0973 specifically, smaller tags at the N-terminus have shown less interference with membrane integration and functional studies .

What are the optimal storage conditions for preserving WS0973 activity?

To maintain optimal activity of recombinant WS0973, follow these research-validated storage recommendations:

  • For long-term storage: Maintain at -20°C or preferably -80°C in a stabilizing buffer containing 50% glycerol

  • For working solutions: Store aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

For highest stability, the recommended storage buffer is Tris-based with 50% glycerol, optimized specifically for this protein . Small volume aliquots should be prepared to minimize freeze-thaw cycles.

If lyophilized format is used, reconstitute immediately before use in the appropriate buffer, and store any unused reconstituted protein according to the guidelines above.

How can experimental design be optimized for studying WS0973 manganese efflux activity?

When designing experiments to study the manganese efflux activity of WS0973, a systematic approach using controlled experimental design is essential. Consider the following methodology:

  • Independent Variables:

    • WS0973 expression levels (wild-type vs. overexpression)

    • Manganese concentration in growth media

    • Presence of other divalent cations (potential competitors)

  • Dependent Variables:

    • Intracellular manganese concentration

    • Cell growth rate under manganese stress

    • Membrane integrity

  • Experimental Design Structure:
    Implement a full factorial design where each independent variable is systematically varied while controlling for extraneous factors . This allows for identification of both main effects and interaction effects between variables.

  • Control Conditions:

    • Negative control: Express inactive WS0973 mutant

    • Positive control: Known manganese efflux protein

    • System control: Empty vector expression

  • Analytical Methods:

    • ICP-MS for precise quantification of intracellular and extracellular manganese

    • Real-time monitoring of manganese flux using fluorescent indicators

    • Growth curve analysis under varying manganese concentrations

This experimental framework enables robust hypothesis testing regarding WS0973's function as a manganese efflux pump while controlling for confounding variables that might affect interpretation .

What approaches can be used to validate the membrane localization of recombinant WS0973?

Validating membrane localization of WS0973 requires multiple complementary approaches:

  • Subcellular Fractionation:

    • Separate membrane fractions from cytosolic components using ultracentrifugation

    • Analyze protein distribution by Western blot with anti-tag antibodies

    • Include controls for membrane markers (e.g., Na+/K+ ATPase) and cytosolic markers (e.g., GAPDH)

  • Confocal Microscopy:

    • Express WS0973 with fluorescent protein tag (e.g., GFP) or use immunofluorescence

    • Co-stain with membrane-specific dyes (e.g., DiI, DiO)

    • Perform z-stack imaging to confirm membrane integration

  • Protease Protection Assay:

    • Treat intact cells or membrane vesicles with proteases

    • Analyze proteolytic fragments to determine topology

    • Compare with detergent-permeabilized samples

  • Surface Biotinylation:

    • Label surface proteins with non-permeable biotinylation reagents

    • Isolate biotinylated proteins using streptavidin affinity

    • Detect WS0973 in the biotinylated fraction

By integrating data from these complementary approaches, researchers can confidently establish the membrane localization and topology of WS0973, which is crucial for understanding its function as an efflux pump .

How can researchers design assays to measure the manganese transport activity of WS0973?

To measure the manganese transport activity of WS0973, researchers should implement the following methodological approaches:

  • Reconstitution in Proteoliposomes:

    • Purify recombinant WS0973 with minimal detergent exposure

    • Reconstitute into liposomes with defined phospholipid composition

    • Create a manganese gradient across the liposome membrane

    • Measure manganese flux using radioactive ^54Mn or fluorescent indicators

  • Whole-Cell Transport Assays:

    • Express WS0973 in manganese-sensitive cell lines

    • Load cells with manganese-sensitive fluorescent dyes (e.g., GPP or Fura-2)

    • Monitor real-time changes in fluorescence upon manganese exposure

    • Compare with cells expressing inactive WS0973 variants

  • Electrophysiological Measurements:

    • Express WS0973 in Xenopus oocytes or form planar lipid bilayers

    • Measure currents associated with manganese transport

    • Determine voltage dependence and kinetics of transport

  • Competition Assays:

    • Assess transport specificity by competing manganese with other divalent cations

    • Create the following data matrix to analyze specificity:

Competing IonConcentration Range (μM)% Inhibition of Mn^2+ Transport
Zinc (Zn^2+)1-1000[Experimental value]
Iron (Fe^2+)1-1000[Experimental value]
Calcium (Ca^2+)1-1000[Experimental value]
Magnesium (Mg^2+)1-1000[Experimental value]
  • Kinetic Analysis:

    • Measure transport rates at varying manganese concentrations

    • Determine Km and Vmax parameters

    • Assess the effects of pH and temperature on transport kinetics

These methodological approaches can be adapted based on specific research questions and available equipment, but they collectively provide a comprehensive framework for characterizing the manganese transport function of WS0973 .

What strategies can be employed to study protein-protein interactions involving WS0973?

Investigating protein-protein interactions of WS0973 requires specialized approaches suitable for membrane proteins:

  • Proximity-Based Labeling:

    • Express WS0973 fused to BioID or APEX2 enzymes

    • Allow in vivo biotinylation of proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

    • Validate interactions with co-immunoprecipitation

  • Cross-Linking Mass Spectrometry (XL-MS):

    • Treat cells expressing WS0973 with membrane-permeable crosslinkers

    • Digest and analyze crosslinked peptides by mass spectrometry

    • Map interaction interfaces at amino acid resolution

    • Create interaction network models

  • Split-Reporter Systems:

    • Fuse WS0973 and potential interacting partners to complementary fragments of reporters (e.g., split GFP, split luciferase)

    • Monitor signal reconstitution as evidence of interaction

    • Perform in membrane-mimetic environments

  • Membrane Two-Hybrid Systems:

    • Adapt yeast or bacterial two-hybrid systems for membrane proteins

    • Screen libraries to identify novel interactors

    • Quantify interaction strength through reporter gene expression

  • Co-Purification Studies:

    • Perform tandem affinity purification with tagged WS0973

    • Identify co-purifying proteins by mass spectrometry

    • Apply stringent controls to eliminate non-specific interactions

These methods can be combined in a multi-tiered approach, with initial high-throughput screening followed by targeted validation of specific interactions. This strategy provides both breadth and depth in characterizing the WS0973 interactome .

How can researchers address low expression yields of recombinant WS0973?

Low expression yields are a common challenge when working with membrane proteins like WS0973. Implement these research-validated strategies to improve expression:

  • Optimization of Expression Conditions:

    • Test multiple induction temperatures (16°C, 25°C, 30°C, 37°C)

    • Vary inducer concentrations (e.g., IPTG: 0.1-1.0 mM)

    • Optimize cell density at induction (OD600: 0.4-1.0)

    • Examine different media formulations (LB, TB, auto-induction media)

  • Codon Optimization:

    • Analyze the WS0973 sequence for rare codons in the expression host

    • Synthesize a codon-optimized gene variant for the specific expression system

    • Co-express rare tRNA genes if using the native sequence

  • Fusion Partners:

    • Test expression with solubility-enhancing fusion partners (MBP, SUMO, Trx)

    • Consider using specialized membrane protein fusion partners (Mistic, YidC)

    • Compare N-terminal versus C-terminal tag placement

  • Modified Expression Vectors:

    • Use vectors with tunable promoter strength

    • Test different signal sequences for membrane targeting

    • Consider specialized membrane protein expression vectors

  • Host Cell Engineering:

    • Use specialized strains with enhanced membrane protein expression capabilities

    • Test strains with altered membrane compositions

    • Consider strains with reduced protease activity

By systematically testing these variables in a controlled experimental design framework, researchers can identify optimal conditions for WS0973 expression, potentially increasing yields by 5-10 fold compared to standard conditions .

What approaches can resolve protein aggregation issues with recombinant WS0973?

Protein aggregation is a significant challenge when working with membrane proteins like WS0973. Implement these methodological solutions:

  • Detergent Screening:

    • Systematically test different detergent classes:

      • Mild detergents: DDM, LMNG, Digitonin

      • Zwitterionic detergents: CHAPS, LDAO

      • Ionic detergents: SDS, Sarkosyl (for initial solubilization only)

    • Use a matrix approach testing different concentrations (0.5-5× CMC)

  • Buffer Optimization:

    • Screen pH range (pH 6.0-9.0)

    • Test different buffer systems (Tris, HEPES, Phosphate)

    • Include stabilizing additives:

      • Glycerol (5-20%)

      • Specific lipids (0.01-0.1 mg/ml)

      • Salt concentration (100-500 mM)

  • Extraction and Purification Conditions:

    • Lower temperature during all handling steps (4°C)

    • Include protease inhibitors and reducing agents

    • Consider on-column refolding methods

    • Use gentle elution conditions with gradient elution

  • Advanced Solubilization Strategies:

    • Try amphipol or SMALPs for detergent-free extraction

    • Test nanodisc reconstitution

    • Consider bicelles or lipid cubic phases

  • Quality Assessment:

    • Perform size-exclusion chromatography to monitor aggregation state

    • Use dynamic light scattering to assess homogeneity

    • Apply thermal stability assays to identify stabilizing conditions

By systematically applying these approaches and analyzing results through controlled experimental design principles, researchers can significantly reduce aggregation issues and obtain functionally active WS0973 suitable for downstream applications .

What experimental approaches can be used to determine the structure-function relationship of WS0973?

Understanding the structure-function relationship of WS0973 requires integrating multiple experimental approaches:

  • Site-Directed Mutagenesis:

    • Identify conserved residues through sequence alignment with other UPF0059 family members

    • Create systematic mutations of:

      • Putative metal-binding residues (acidic and histidine residues)

      • Transmembrane domain residues

      • Potential gating regions

    • Assess functional consequences using transport assays

    • Create the following analytical matrix:

MutationLocationStructural ElementTransport Activity (% of WT)Membrane Localization
D45ATM domainMetal binding[Experimental value][Yes/No/Partial]
H78ATM domainMetal binding[Experimental value][Yes/No/Partial]
R120ACytoplasmicGating[Experimental value][Yes/No/Partial]
[Other][Location][Element][Experimental value][Yes/No/Partial]
  • Limited Proteolysis:

    • Identify protected regions indicating structural domains

    • Compare proteolytic patterns with and without substrate binding

    • Map flexible regions involved in conformational changes

  • Cysteine Scanning Mutagenesis:

    • Introduce single cysteines throughout the protein

    • Label with environment-sensitive probes

    • Assess accessibility changes upon substrate binding

    • Map the transport pathway through the membrane

  • Molecular Dynamics Simulations:

    • Generate homology models based on related structures

    • Simulate protein dynamics in membrane environments

    • Predict substrate binding sites and transport mechanisms

    • Validate computational predictions experimentally

  • Cross-Linking Studies:

    • Identify residues that come into proximity during transport cycle

    • Use bifunctional crosslinkers of various lengths

    • Map conformational changes associated with transport

By integrating data from these complementary approaches, researchers can develop a comprehensive model of how WS0973 structure relates to its manganese efflux function .

How can WS0973 research contribute to understanding bacterial metal homeostasis systems?

WS0973 research provides a valuable model system for investigating broader questions about bacterial metal homeostasis:

  • Comparative Analysis Approaches:

    • Compare WS0973 with other bacterial manganese transporters

    • Analyze conservation patterns across bacterial species

    • Investigate evolutionary relationships between different classes of metal transporters

    • Examine how metal transport systems adapted to different environmental niches

  • Systems Biology Integration:

    • Map the regulatory network controlling WS0973 expression

    • Identify transcription factors responding to manganese levels

    • Create integrative models of manganese homeostasis

    • Apply network analysis to understand redundancy and robustness

  • Methodological Framework for Metal Homeostasis Studies:

    • Design experimental protocols that can be applied to other metal transport systems

    • Develop standardized assays for metal transport activity

    • Create databases of metal transporter characteristics

    • Establish comparative metrics for transporter efficiency and specificity

  • Translational Research Directions:

    • Investigate connections between metal homeostasis and bacterial pathogenesis

    • Explore WS0973 homologs in clinically relevant bacteria

    • Assess potential of manganese transport systems as antimicrobial targets

    • Develop high-throughput screening methods for metal transport inhibitors

By positioning WS0973 research within these broader contexts, researchers can maximize the impact of their findings and contribute to foundational understanding of bacterial physiology and potential applications in fields like infectious disease and biotechnology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.