Recombinant UPF0059 membrane protein WS1268 (WS1268)

Shipped with Ice Packs
In Stock

Description

Production & Purification

Expression Protocol

  1. Vector system: pET-based plasmids with T7 promoters .

  2. Induction: IPTG-driven expression in E. coli membranes .

  3. Extraction: Detergent-based solubilization (e.g., Triton X-100 or octyl glucoside) .

Optimization Strategies

  • MembraneMax™ kits: Enhance solubility using nanolipoprotein particles for proper folding .

  • Strain engineering: Modified E. coli BL21 strains improve yield .

Purification Workflow

  • Immobilized metal affinity chromatography (IMAC) for His-tag isolation .

  • Buffer exchange into Tris/PBS with 6% trehalose for stability .

Functional Insights

Biological Role

  • Putative manganese efflux pump: Homology with mntP2 genes suggests involvement in Mn²⁺ homeostasis .

  • Membrane topology: Predicted 4–6 transmembrane helices based on UPF0059 family motifs .

Experimental Validation

  • Protease accessibility: Limited cleavage sites in reconstituted liposomes indicate tight β-barrel folding .

  • Dynamic studies: Solid-state NMR reveals nanosecond-scale motions in homologous proteins .

Research Applications

Key Use Cases

  • Structural biology: Crystallography or cryo-EM studies using purified protein .

  • Metal transport assays: Measuring Mn²⁺ flux in liposome-reconstituted systems .

  • Antigen development: Cross-reactivity studies with Escherichia and Salmonella orthologs .

Technical Challenges

  • Aggregation: Requires lipid mimics (e.g., DMPC) during reconstitution .

  • Yield limitations: Evolved Lactococcus lactis strains show promise for scaling production .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP2; WS1268; Putative manganese efflux pump MntP 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) (Vibrio succinogenes)
Target Names
mntP2
Target Protein Sequence
MIELTALAIALSMDAVAVSIALGSKCEEEIRQLALKAGGFFGVAQMVMPLLGFYLGVQLH DYIGGIHHWVALGVLGFLGLKMIREATQGEKELALSSHPSSSKLLLLAFVTSLDAMAAGL TLTLLGLPLWFCLLFIGGSTFLLSFGGVHLGRKSGTYLEEKAEYLGGIILILIGVKIFIE HS
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links

KEGG: wsu:WS1268

STRING: 273121.WS1268

Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What are the optimal storage conditions for Recombinant WS1268 protein in laboratory settings?

    For optimal stability and activity of Recombinant WS1268 protein, the following storage protocol is recommended:

    • Store lyophilized powder at -20°C/-80°C upon receipt

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended)

    • Aliquot to avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for up to one week

    The protein is typically provided in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0. Repeated freezing and thawing should be avoided as it may lead to protein degradation and loss of functional activity .

Advanced Research Questions

  • What experimental approaches are most effective for studying WS1268 membrane protein function?

    Studying membrane protein function requires specialized approaches. For WS1268, consider the following methodological framework:

    1. Protein Reconstitution in Liposomes: After purification, reconstitute WS1268 in liposomes to mimic its native membrane environment. Use a mixture of phospholipids that resemble bacterial membranes.

    2. Transport Assays: As a putative manganese efflux pump, design assays using radiolabeled Mn²⁺ or fluorescent manganese indicators to measure transport activity across the liposomal membrane.

    3. Site-Directed Mutagenesis: Create strategic mutations in conserved domains to identify residues critical for substrate binding and transport.

    4. Electrophysiology: Consider patch-clamp techniques on reconstituted proteins to measure ion conductance.

    5. Structural Analysis: Employ techniques such as X-ray crystallography or cryo-electron microscopy to determine the three-dimensional structure, particularly focusing on transmembrane domains and potential substrate binding sites.

    The 90% purity of commercially available recombinant WS1268 makes it suitable for most of these functional studies, though higher purity may be required for structural analyses .

  • How can researchers effectively design experiments to characterize the manganese transport activity of WS1268?

    To characterize the manganese transport activity of WS1268, researchers should implement a systematic experimental design:

    Experimental PhaseMethodologyExpected OutcomesControls
    Substrate SpecificityCompetitive inhibition assays with various metal ionsDetermination of substrate preferenceWS0973 (mntP1) for comparative analysis
    Transport KineticsMeasurement of transport rates at varying substrate concentrationsKm and Vmax valuesNo-protein liposomes
    Energy DependenceAssays in presence/absence of ATP, pH gradientsDetermination of energy coupling mechanismIonophores to dissipate gradients
    Inhibitor ProfilingTransport assays with potential inhibitorsIdentification of selective inhibitorsKnown transport inhibitors

    Include proper controls such as empty liposomes and heat-inactivated protein preparations. For comprehensive characterization, compare the transport properties of WS1268 with WS0973 to understand potential functional differences between these related proteins .

  • What are the challenges in expressing and purifying functional WS1268 for structural studies?

    Expressing and purifying membrane proteins like WS1268 for structural studies presents several challenges:

    1. Protein Aggregation: The hydrophobic transmembrane domains can cause aggregation during expression and purification. To address this, use specialized detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) during extraction and purification.

    2. Maintaining Native Conformation: The protein must retain its native conformation during purification. Consider using mild solubilization conditions and adding stabilizing agents like glycerol or specific lipids.

    3. Expression Systems: While E. coli is commonly used, it may not provide the optimal membrane environment. Consider alternative expression systems like Pichia pastoris for higher yields of properly folded protein.

    4. Purification Strategy: The His-tag on commercially available WS1268 facilitates initial purification, but additional chromatography steps may be necessary to achieve the purity required for structural studies (>95%).

    5. Functional Verification: After purification, verify that the protein remains functional through transport assays before proceeding to structural studies.

    These challenges highlight the importance of optimizing each step from expression to final purification to obtain sufficient quantities of functional protein for structural analyses .

  • How can researchers distinguish between the functions of WS1268 (mntP2) and WS0973 (mntP1) in experimental systems?

    Distinguishing between the functions of these two related proteins requires a multifaceted approach:

    1. Differential Expression Analysis: Study the expression patterns of both genes under various conditions, particularly under different metal stress conditions. This may reveal condition-specific expression profiles.

    2. Knockout/Complementation Studies: Create single and double knockout strains in model organisms, then complement with either gene to assess functional redundancy or specialization.

    3. Transport Specificity Assays: Compare substrate specificity profiles using purified proteins reconstituted in liposomes. While both are putative manganese transporters, they may have different affinities for manganese or other divalent cations.

    4. Structural Comparisons: Analyze the structural differences between the two proteins, focusing on potential substrate binding sites and transmembrane domains. The amino acid sequence differences (as detailed in Question 2) suggest potential functional variations.

    5. Localization Studies: Determine if these proteins localize to different membrane regions or compartments within bacterial cells, which could indicate specialized functions.

    This systematic approach will help elucidate whether these proteins have redundant functions or have evolved specialized roles in manganese homeostasis .

  • What methodological approaches can be used to study the role of WS1268 in manganese homeostasis in bacterial systems?

    To investigate the role of WS1268 in bacterial manganese homeostasis, consider implementing these methodologies:

    1. Genetic Manipulation: Create knockout mutants of the mntP2 gene encoding WS1268 in Wolinella succinogenes or in heterologous bacterial systems. Complement with wild-type or mutated versions to assess functional recovery.

    2. Metal Content Analysis: Use inductively coupled plasma mass spectrometry (ICP-MS) to quantify intracellular manganese levels in wild-type versus mutant strains under various conditions.

    3. Metal Sensitivity Assays: Assess growth of wild-type versus mutant strains under varying manganese concentrations to determine if loss of WS1268 leads to manganese sensitivity or resistance.

    4. Transcriptomic Responses: Use RNA-Seq to identify genes co-regulated with mntP2 under manganese stress, potentially revealing functional networks.

    5. Real-time Transport Measurements: Develop fluorescent sensor systems to monitor manganese flux in living bacterial cells in real-time.

    Data collected using these approaches should be organized in tables comparing wild-type and mutant strains across different experimental conditions, facilitating clear interpretation of WS1268's role in manganese homeostasis .

Advanced Technical Questions

  • What are the critical considerations when designing site-directed mutagenesis experiments for WS1268?

    When designing site-directed mutagenesis experiments for WS1268, researchers should consider these critical factors:

    1. Target Selection: Prioritize conserved residues in the UPF0059 family, particularly those in predicted transmembrane domains or potential metal-binding sites. Analyze the amino acid sequence (provided in Question 1) to identify charged residues within transmembrane regions that might be involved in cation transport.

    2. Mutation Strategy:

      • Conservative mutations: Replace residues with similarly sized/charged amino acids to probe specific chemical properties

      • Non-conservative mutations: Create more dramatic changes to test essentiality of specific positions

      • Alanine scanning: Systematically replace consecutive residues with alanine to map functional regions

    3. Expression Verification: Ensure mutants are properly expressed and localized, as mutations can affect protein folding and membrane insertion. Western blotting using the His-tag can verify expression levels.

    4. Functional Assays: Design assays that specifically test the hypothesized function of the mutated residue. For putative metal-binding sites, measure changes in metal affinity.

    5. Controls: Always include wild-type WS1268 as a positive control and consider including WS0973 mutations at equivalent positions for comparative analysis.

    By systematically mutating key residues and assessing functional consequences, researchers can develop a detailed structure-function map of WS1268 .

  • How can researchers develop effective assays to study the potential interaction of WS1268 with other components of bacterial metal homeostasis systems?

    To study potential interactions between WS1268 and other components of bacterial metal homeostasis systems, consider these methodological approaches:

    1. Co-Immunoprecipitation (Co-IP): Use anti-His antibodies to pull down His-tagged WS1268 and identify interacting partners by mass spectrometry. This approach can reveal protein-protein interactions within the metal homeostasis network.

    2. Bacterial Two-Hybrid System: Create fusion constructs of WS1268 and potential interacting partners to screen for interactions in vivo.

    3. Fluorescence Resonance Energy Transfer (FRET): Tag WS1268 and candidate interacting proteins with appropriate fluorophores to detect proximity-based energy transfer as evidence of interaction.

    4. Split Ubiquitin System: This modified yeast two-hybrid approach is particularly useful for membrane protein interactions.

    5. Genetic Interaction Screens: Create double knockout strains (WS1268 plus another metal homeostasis component) to identify synthetic lethal or suppressor interactions, suggesting functional relationships.

    6. Quantitative Proteomics: Compare the proteome of wild-type and WS1268 knockout strains to identify compensatory changes in other metal transport systems.

    These approaches should be combined to build a comprehensive interaction network, as each method has specific strengths and limitations in detecting different types of interactions .

  • What are the most effective strategies for reconstituting WS1268 in artificial membrane systems for functional studies?

    Reconstituting membrane proteins like WS1268 in artificial membrane systems requires careful optimization. The following strategies have proven effective:

    Reconstitution MethodProtocol ComponentsAdvantagesLimitations
    Detergent-mediated reconstitution1. Solubilize protein in mild detergent
    2. Mix with lipids
    3. Remove detergent via dialysis or adsorption
    Simple procedure, good control over protein orientationPotential protein denaturation during detergent removal
    Direct incorporation1. Add protein during liposome formation
    2. Freeze-thaw cycles
    3. Extrusion for size uniformity
    Minimal exposure to detergentsLower efficiency, random orientation
    Droplet interface bilayers1. Create water-in-oil droplets
    2. Form bilayer at droplet interfaces
    3. Insert protein
    Amenable to electrical measurementsTechnical complexity, lower throughput
    Nanodisc technology1. Mix protein, lipids, and membrane scaffold proteins
    2. Remove detergent
    3. Purify nanodiscs
    Defined size, stable, soluble in aqueous solutionLimited membrane area, higher cost

    For WS1268, the recommended approach is detergent-mediated reconstitution using DDM or LMNG detergents, followed by detergent removal via Bio-Beads. The reconstitution buffer should contain stabilizing agents like glycerol and maintain pH 7.5-8.0 to preserve protein function. Verification of successful reconstitution should include freeze-fracture electron microscopy and functional transport assays .

  • How can researchers differentiate between direct and indirect effects when studying the impact of WS1268 on bacterial metal resistance?

    Differentiating between direct and indirect effects of WS1268 on bacterial metal resistance requires a systematic experimental approach:

    1. Direct Measurement of Transport Function:

      • Develop in vitro transport assays using purified protein in liposomes to demonstrate direct manganese transport

      • Measure manganese uptake/efflux rates in cells overexpressing WS1268 compared to control cells

      • Use radioactive ⁶⁴Mn or fluorescent indicators for direct transport measurement

    2. Uncoupling from Secondary Responses:

      • Use rapid kinetic measurements to distinguish immediate transport events from slower transcriptional responses

      • Employ protein synthesis inhibitors to block secondary adaptive responses

      • Create transcriptionally inactive mutants that retain transport function

    3. Dose-Response Relationships:

      • Establish quantitative relationships between WS1268 expression levels and manganese resistance

      • A direct effect should show proportional relationship between expression and resistance

    4. Specificity Controls:

      • Test resistance to other metals to confirm specificity for manganese

      • Use transport-deficient WS1268 mutants as negative controls

      • Compare with effects of WS0973 (mntP1) to identify protein-specific functions

    5. Systems Biology Approach:

      • Integrate transcriptomics, proteomics, and metabolomics data to map the network effects of WS1268 deletion/overexpression

      • Use computational modeling to distinguish primary from secondary effects

    These approaches, applied in combination, provide compelling evidence to differentiate direct transport functions from indirect regulatory effects of WS1268 on metal resistance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.