Recombinant UPF0060 membrane protein Mb2672c (Mb2672c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BQ2027_MB2672C; UPF0060 membrane protein Mb2672c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB2672C
Target Protein Sequence
MVVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQPDAHFGR VLAAYGGVFVAGSLAWGMALDGFRPDRWDVIGALGCMAGVAVIMYAPRGH
Uniprot No.

Target Background

Protein Families
UPF0060 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0060 membrane protein Mb2672c and why is it significant to study?

UPF0060 membrane protein Mb2672c (Y2672, BQ2027_MB2672C) is a 112-amino acid integral membrane protein from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) . It belongs to the UPF (Uncharacterized Protein Family) designation, indicating its function remains largely uncharacterized. Studying this protein is significant for several reasons: it may reveal novel membrane transport mechanisms in mycobacteria, potentially contribute to understanding pathogenicity in M. bovis (a close relative of M. tuberculosis), and expand our knowledge of membrane protein structure-function relationships. Research approaches should include comparative genomics with other mycobacterial species, functional assays to determine substrate specificity, and structural characterization to elucidate its membrane topology.

How does Mb2672c compare structurally to other UPF0060 family proteins?

Structural comparison between Mb2672c and other UPF0060 family members such as SAV2339 from Staphylococcus aureus (110 amino acids) and other bacterial homologs reveals conservation patterns that may indicate functional importance . Methodologically, researchers should apply sequence alignment tools to identify conserved residues, predict transmembrane domains using topology prediction algorithms (TMHMM, TOPCONS), and where available, compare experimental structural data (X-ray crystallography or cryo-EM) to identify structural motifs. This comparative approach helps establish evolutionary relationships and potentially extrapolate functional information from better-characterized family members. Molecular modeling approaches can further predict structural features when experimental structures are unavailable.

What expression systems are most effective for recombinant UPF0060 membrane protein Mb2672c production?

For effective recombinant production of Mb2672c, researchers should consider several expression systems with specific methodological considerations:

  • Bacterial expression systems: E. coli BL21(DE3) or C41/C43 strains (specialized for membrane proteins) with vectors containing mild promoters to prevent toxic overexpression. Fusion tags like MBP can improve solubility .

  • Yeast expression: Pichia pastoris can provide proper protein folding and post-translational modifications closer to native mycobacterial conditions.

  • Insect cell expression: Baculovirus expression systems offer advantages for complex membrane proteins that require eukaryotic processing machinery .

For mycobacterial membrane proteins specifically, optimizing codon usage for the host organism, controlling induction temperature (typically lowering to 16-18°C to slow expression), and using specialized detergents for extraction are critical methodological considerations. Success should be validated through Western blotting to confirm expression of the full-length protein before proceeding to purification steps.

What purification strategies overcome challenges specific to Mb2672c as a membrane protein?

Purifying Mb2672c requires specialized approaches that address the hydrophobic nature of membrane proteins:

  • Detergent screening: Systematically test multiple detergents (DDM, LMNG, Triton X-100) at various concentrations to identify optimal solubilization conditions without denaturing the protein .

  • Two-step affinity chromatography: Using His-tag or other fusion tags for initial capture, followed by size exclusion chromatography to ensure homogeneity and remove aggregates .

  • Novel solubilization approaches: Consider water-soluble WRAP (Water-soluble RFdiffused Amphipathic Proteins) technology, which uses designed proteins to surround hydrophobic surfaces of membrane proteins, enhancing stability in aqueous solutions without detergents .

The methodological quality control should include dynamic light scattering to assess homogeneity, SDS-PAGE with Coomassie staining to verify purity, and Western blotting to confirm identity. For structural studies, researchers should verify protein stability in the chosen detergent using thermal shift assays.

How can researchers determine the membrane topology and structure of Mb2672c?

Determining the membrane topology and structure of Mb2672c requires a multi-technique approach:

  • Computational prediction: Begin with hydropathy analysis and transmembrane domain prediction using algorithms like TMHMM, TOPCONS, and PredictProtein to generate initial topology models.

  • Experimental validation: Employ techniques such as:

    • Cysteine scanning mutagenesis with accessibility reagents

    • Fluorescence spectroscopy with strategically placed tryptophan residues

    • Limited proteolysis followed by mass spectrometry to identify exposed regions

    • Epitope mapping with antibodies against specific domains

  • Structural determination: For high-resolution structures, consider:

    • X-ray crystallography requiring specialized lipidic cubic phase crystallization

    • Single-particle cryo-EM with detergent micelles or nanodiscs

    • NMR spectroscopy for smaller membrane proteins or domains

When adapting these methods specifically for Mb2672c, researchers must optimize detergent conditions to maintain native folding while removing enough lipids to allow structural determination. For cryo-EM approaches, protein concentration typically needs to be in the low μM to high nM range with high purity (≥95%) .

What methodological approaches can identify potential binding partners or substrates of Mb2672c?

To identify binding partners or substrates of this uncharacterized membrane protein:

  • Pull-down assays: Using purified Mb2672c as bait to capture interacting proteins from mycobacterial lysates, followed by mass spectrometry identification.

  • Cross-linking mass spectrometry: Employing chemical cross-linkers to stabilize transient interactions before MS analysis.

  • Transport assays: Reconstituting purified Mb2672c into liposomes or nanodiscs with fluorescent substrates to monitor potential transport activity.

  • SMFS (Single-Molecule Force Spectroscopy): This technique can provide insights into protein-ligand interactions at the single-molecule level by measuring the forces required to unfold the protein in the presence/absence of substrates .

  • Computational docking: Virtual screening of potential ligands against homology models can generate hypotheses for experimental validation.

For methodological rigor, all potential interactions should be validated through complementary techniques, and negative controls including non-specific membrane proteins should be employed to filter out false positives commonly encountered with hydrophobic membrane proteins.

How can mass spectrometry be optimized for intact analysis of recombinant Mb2672c?

Mass spectrometry of intact membrane proteins like Mb2672c requires specific methodological considerations:

  • Sample preparation:

    • Protein concentration should be in the low μM to high nM range

    • Buffer exchange into MS-compatible solutions (typically ammonium acetate)

    • Careful detergent selection with C8E4 or DDM being preferred options

    • Homogeneous preparations equivalent to crystallographic-grade material

  • Instrumentation parameters:

    • Nano-electrospray ionization (nESI) with gold-coated capillaries

    • Elevated collision energies to remove bound detergent molecules

    • Increased pressure in the collision cell to improve transmission

  • Data analysis:

    • Deconvolution algorithms specialized for membrane proteins

    • Consideration of bound lipids and detergent molecules in mass calculations

    • Analysis of charge state distributions to assess protein folding

For Mb2672c specifically, researchers should start with small-scale optimization experiments using 3-5 μL of sample, noting that even concentrations below 10 nM have yielded successful mass spectra for membrane proteins . The methodological approach should include controls to distinguish between protein-specific signals and detergent-related artifacts.

How can Single-Molecule Force Spectroscopy (SMFS) provide insights into Mb2672c structure and function?

SMFS offers unique insights into membrane protein structure-function relationships through the following methodological approaches:

  • Sample preparation:

    • Reconstitution of purified Mb2672c into lipid bilayers

    • Attachment of the protein to an AFM cantilever via specific tags

    • Careful control of pulling direction (N- vs C-terminus)

  • Data acquisition and analysis:

    • Collection of force-distance curves during protein unfolding

    • Cluster analysis to identify distinct unfolding patterns

    • Correlation with predicted secondary structure elements

    • Bayesian meta-analysis to interpret unfolding spectra

  • Functional insights:

    • Comparative unfolding in the presence vs. absence of potential ligands

    • Detection of conformational changes under different environmental conditions

    • Assessment of protein stability through unfolding force measurements

This technique is particularly valuable for membrane proteins like Mb2672c where traditional structural methods may be challenging. SMFS can provide information on the number and stability of transmembrane segments and detect conformational changes upon substrate binding, offering functional insights even without a complete high-resolution structure .

What strategies can improve stability and solubility of recombinant Mb2672c for structural studies?

Improving stability and solubility of recombinant Mb2672c requires specialized approaches:

  • Fusion partner engineering:

    • N-terminal MBP or SUMO tags to enhance folding and solubility

    • T4 lysozyme insertion in flexible loops to provide crystal contacts

    • Thermostabilizing fluorescent protein fusions

  • Protein stabilization approaches:

    • Alanine scanning to identify and replace destabilizing residues

    • Disulfide engineering to lock flexible regions

    • WRAP technology using designed proteins to shield hydrophobic surfaces

  • Lipid nanodisc incorporation:

    • Reconstitution into MSP nanodiscs with optimized lipid composition

    • SapNP or copolymer-based nanodiscs for improved stability

    • Systematic screening of lipid compositions that mimic mycobacterial membranes

For methodological implementation, researchers should conduct parallel stability assays (thermal shift, SEC-MALS, DLS) to benchmark improvements, focusing on protein monodispersity and functional retention rather than just yield. The optimal stabilization approach will balance structural integrity with maintaining native function of Mb2672c.

How can researchers design recombinant Mb2672c constructs for specific experimental applications?

Designing optimized recombinant Mb2672c constructs requires methodological consideration of the experimental endpoint:

  • For crystallography/cryo-EM studies:

    • Truncation of flexible termini based on disorder prediction

    • Strategic placement of affinity tags with TEV cleavage sites

    • Surface entropy reduction mutations to promote crystal contacts

    • Fusion with crystallization chaperones such as T4 lysozyme or BRIL

  • For functional assays:

    • Minimal modifications to preserve native function

    • Strategic tagging for orientation control in liposome reconstitution

    • Site-directed mutagenesis of predicted functional residues

    • Fluorescent protein fusions positioned to avoid interference with function

  • For protein-protein interaction studies:

    • Split reporter fusions for in vivo interaction assays

    • BirA-based proximity labeling constructs

    • FRET pairs insertion at specific sites

The construct design should begin with bioinformatic analysis of sequence conservation across UPF0060 family members to identify regions likely essential for function versus those amenable to modification . Testing multiple constructs in parallel often proves most efficient, with successful designs validated through expression testing, stability assessment, and functional assays before proceeding to larger-scale production.

How does studying Mb2672c contribute to understanding mycobacterial physiology?

Studying Mb2672c contributes to understanding mycobacterial physiology through several methodological approaches:

  • Gene knockout/knockdown studies:

    • CRISPR interference to reduce expression

    • Generation of conditional mutants

    • Phenotypic analysis under various growth conditions

  • Comparative genomics:

    • Analysis of conservation across pathogenic and non-pathogenic mycobacteria

    • Identification of genetic linkage with metabolic pathways

    • Coexpression analysis to predict functional relationships

  • Localization studies:

    • Fluorescent protein fusions to determine subcellular distribution

    • Immunoelectron microscopy for high-resolution localization

    • Fractionation studies to confirm membrane association

Understanding Mb2672c may reveal insights into membrane transport mechanisms specific to mycobacteria, potentially including roles in nutrient acquisition, drug efflux, or cell envelope maintenance. The methodological approach should include cross-species comparisons with M. tuberculosis homologs to establish relevance to pathogenicity and potential as a drug target.

What techniques can determine if Mb2672c functions as a transporter, and what might it transport?

Determining if Mb2672c functions as a transport protein requires specialized functional assays:

  • Liposome reconstitution assays:

    • Purified protein reconstitution into liposomes

    • Loading of fluorescent substrates to monitor transport

    • Ion flux measurements using voltage-sensitive dyes

    • Radioactive substrate uptake studies

  • Cellular transport assays:

    • Heterologous expression in transport-deficient bacterial strains

    • Growth complementation with specific nutrients

    • Measurement of substrate accumulation in cells overexpressing Mb2672c

    • Inhibitor studies to validate specificity

  • Structural and computational approaches:

    • Homology modeling and comparison with known transporters

    • Molecular dynamics simulations to identify potential substrate pathways

    • Docking studies with candidate substrates

For methodological implementation, researchers should begin with broad substrate screening (ions, sugars, amino acids, lipids) and narrow down based on results. The substrate specificity may be informed by the genetic context of Mb2672c in the M. bovis genome and comparison with better-characterized homologs in other bacterial species . Controls should include non-functional mutants (e.g., predicted pore-blocking mutations) to confirm specificity of transport.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.