Recombinant UPF0060 membrane protein Rv2639c/MT2717 (Rv2639c, MT2717)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is defined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Target Names
Rv2639c, MT2717
Target Protein Sequence
MVVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQPDAHFGR VLAAYGGVFVAGSLAWGMALDGFRPDRWDVIGALGCMAGVAVIMYAPRGH
Uniprot No.

Q&A

What is UPF0060 membrane protein Rv2639c/MT2717?

Rv2639c/MT2717 is a conserved membrane protein from Mycobacterium tuberculosis H37Rv strain belonging to the UPF0060 (Uncharacterized Protein Family 0060) classification. The gene is located at positions 2965026-2965358 on the negative strand of the M. tuberculosis H37Rv genome . The protein consists of 111 amino acids and is predicted to be integrated into the mycobacterial cell membrane . Structural analysis suggests it contains transmembrane domains characteristic of integral membrane proteins.

What is the genomic context and conservation of Rv2639c/MT2717?

The Rv2639c gene is highly conserved across mycobacterial species. According to genomic databases, it belongs to ortholog group 3935 and has several identified homologs including:

SpeciesOrtholog Identifier
M. smegmatisMSMEG_3252
M. abscessusMAB2597
M. marinumMMAR_2961
Other speciesMkms_2558, Mmcs_2513, Mvan_3406, nfa36830, SAV4756

This high degree of conservation across mycobacterial species suggests the protein may play an important biological role, despite being classified as non-essential in standard laboratory growth conditions .

Is Rv2639c essential for M. tuberculosis survival?

Essentiality studies using both transposon sequencing (TnSeq) and CRISPR interference (CRISPRi) methodologies have classified Rv2639c as non-essential for in vitro growth of M. tuberculosis . The protein has a vulnerability index (VI) of 0.8530, with lower and upper bounds of -0.3190 and 2.5680, respectively . This moderate VI score suggests that while not absolutely required for growth under standard laboratory conditions, the protein may contribute to fitness under specific environmental conditions or stresses that M. tuberculosis encounters during infection.

What expression systems are recommended for recombinant production of Rv2639c/MT2717?

Based on published protocols, E. coli expression systems are predominantly used for recombinant production of Rv2639c/MT2717. Specifically:

Expression System ComponentRecommended Options
E. coli strainBL21(DE3) CodonPlus-RP or C43(DE3)
Expression vectorspET16b or pET29b(+)
Protein tagHis-tag (N-terminal)
Detection methodsCoomassie staining and/or Western blotting

The full-length protein (110 amino acids) has been successfully expressed in E. coli with His-tagging, enabling purification via affinity chromatography . For challenging membrane proteins that fail to express in standard BL21(DE3) strains, the C43(DE3) strain (which was specifically developed for expressing toxic membrane proteins) can serve as an alternative expression host .

What structural information is available for UPF0060 membrane proteins?

While no experimentally determined structure exists specifically for Rv2639c/MT2717, computational structural models of related UPF0060 family proteins provide insights. AlphaFold has generated a model for a UPF0060 membrane protein (Ajs_1326) from Acidovorax sp. JS42 with a global pLDDT (predicted Local Distance Difference Test) score of 85.6, indicating a confident prediction . This model could serve as a template for understanding the structural features of Rv2639c/MT2717.

For experimental structure determination, recent advances in membrane protein structural biology suggest several approaches:

  • Nuclear Magnetic Resonance (NMR) spectroscopy using lipid nanodiscs

  • Cryo-electron microscopy (cryo-EM)

  • X-ray crystallography with appropriate detergents

The lipid nanodisc approach is particularly valuable as it provides a native-like lipid bilayer environment for membrane proteins . These nanodiscs consist of a patch of lipid bilayer encircled by membrane scaffold proteins (MSPs) and can be designed in various sizes (6-26 nm diameter) to accommodate different membrane proteins .

What methodological approaches are optimal for studying membrane proteins like Rv2639c/MT2717?

A multi-faceted approach combining several techniques is recommended for comprehensive characterization:

Expression and Purification

For membrane proteins like Rv2639c/MT2717, optimizing expression conditions is critical. In large-scale studies of M. tuberculosis membrane proteins, approximately 51% of targeted membrane protein ORFs were successfully expressed . Key considerations include:

  • Codon optimization for the expression host

  • Careful design of construct boundaries

  • Selection of appropriate detergents for solubilization

  • Assessment of protein localization (membrane fraction, inclusion bodies, or soluble fraction)

  • Purification under conditions that maintain protein stability and native conformation

Structural Characterization

For structural studies, NMR spectroscopy with lipid nanodiscs offers advantages for membrane proteins:

  • Sample preparation: Insert purified Rv2639c/MT2717 into lipid nanodiscs with controlled protein:nanodisc ratio for optimal homogeneity

  • Nanodisc optimization: Use circularized MSPs produced through protein ligation methods for better size homogeneity and stability

  • Size selection: Choose appropriate nanodisc diameter (6-26 nm) based on protein dimensions

  • Verification: Develop robust assays to confirm proper insertion of the membrane protein into nanodiscs

Alternatively, computational approaches using deep learning pipelines have demonstrated success in designing soluble analogues of integral membrane proteins while preserving their structural features . This approach could potentially generate soluble variants of Rv2639c/MT2717 that retain key structural elements but are easier to express and characterize.

How does gene expression of Rv2639c/MT2717 vary across different conditions?

While specific transcriptomic data for Rv2639c/MT2717 is limited in the provided search results, general principles from M. tuberculosis transcriptomics studies provide a framework for investigation:

  • Strain variation: Genetic differences between M. tuberculosis strains significantly impact global gene expression patterns. Some strain-specific signatures have been identified, such as upregulation of the dosR two-component regulator in Beijing strains .

  • Environmental conditions: Expression studies should examine Rv2639c/MT2717 transcription under conditions relevant to infection, including:

    • Hypoxia

    • Nitrosative stress

    • Nutrient starvation

    • Acidic pH

    • Exposure to host immune factors

  • Growth phase: M. tuberculosis undergoes distinct phases during infection (acute, chronic, latent), each with characteristic gene expression patterns . Analyzing Rv2639c/MT2717 expression across these phases could provide functional insights.

  • Experimental approaches: RNA-seq and quantitative PCR are preferred methods for measuring gene expression, with careful normalization against appropriate reference genes.

What challenges are associated with the study of Rv2639c/MT2717?

Researchers face several technical challenges when working with membrane proteins like Rv2639c/MT2717:

  • Expression difficulties: In comprehensive studies of M. tuberculosis membrane proteins, not all targeted proteins were successfully expressed despite optimization efforts . Alternative expression systems (yeast, insect cells) might be considered if E. coli expression fails.

  • Proper folding: Ensuring correct folding and membrane insertion is critical. Evaluation of protein functionality or structural integrity post-purification is necessary to confirm biological relevance.

  • Structural heterogeneity: Membrane proteins often exhibit conformational heterogeneity, particularly when extracted from their native lipid environment. Lipid nanodiscs help mitigate this issue by providing a more native-like environment .

  • Functional characterization: Since the physiological function of Rv2639c/MT2717 remains unknown, designing appropriate functional assays presents a challenge. Systematic approaches including protein-protein interaction studies, metabolite binding assays, and phenotypic analysis of gene deletion mutants may be necessary.

How might computational approaches complement experimental studies of Rv2639c/MT2717?

Computational methods can enhance experimental research on Rv2639c/MT2717 in several ways:

  • Structural prediction: Beyond AlphaFold predictions, molecular dynamics simulations can model protein behavior within membrane environments.

  • Functional prediction: Computational approaches can predict potential functions based on:

    • Structural similarities to characterized proteins

    • Conservation patterns across species

    • Genomic context and potential operonic relationships

    • Protein-protein interaction networks

  • Design of soluble analogues: Deep learning pipelines have successfully designed soluble analogues of membrane proteins while preserving key structural features . These analogues can be more amenable to traditional structural and biochemical characterization methods.

  • Rational mutagenesis: Computational analysis can identify residues likely critical for structure or function, guiding site-directed mutagenesis experiments.

What are the best practices for cloning and expressing Rv2639c/MT2717?

Based on experiences with similar mycobacterial membrane proteins, the following protocol is recommended:

  • Gene optimization: Design the synthetic gene with optimized codon usage for the expression host, particularly optimizing the first 10-15 codons .

  • Vector selection: pET16b or pET29b(+) vectors with T7 promoters have shown success for mycobacterial membrane proteins .

  • Expression conditions optimization:

    • Test multiple E. coli strains (BL21(DE3) CodonPlus-RP, C43(DE3))

    • Vary induction temperatures (16°C, 25°C, 37°C)

    • Test different IPTG concentrations (0.1-1.0 mM)

    • Consider auto-induction media

  • Expression analysis: Examine protein distribution between inclusion bodies, soluble fraction, and membrane fraction using both Coomassie staining and Western blotting with anti-His antibodies .

In one large-scale study of mycobacterial membrane proteins, approximately half of the targeted proteins were successfully expressed using these approaches, with varying distributions between cellular fractions .

How can structural studies of Rv2639c/MT2717 inform drug discovery efforts?

Structural characterization of Rv2639c/MT2717 could potentially support tuberculosis drug discovery efforts through:

  • Identification of druggable pockets or binding sites that could be targeted by small molecules

  • Rational design of inhibitors if the protein is found to have an essential function or contribute to virulence

  • Understanding of membrane protein topology in mycobacteria, which could inform broader approaches to targeting the mycobacterial cell envelope

  • Development of soluble functional analogues of this membrane protein that retain key structural features but are easier to work with in drug screening assays

Recent advances in computational design have demonstrated that complex membrane protein topologies can be recapitulated in soluble proteins, potentially enabling new approaches to drug discovery targeting membrane proteins .

How might genetic approaches further elucidate the function of Rv2639c/MT2717?

While Rv2639c has been classified as non-essential under standard in vitro conditions , more sophisticated genetic approaches could reveal conditional essentiality or functional roles:

  • Conditional knockdown: Using inducible CRISPRi systems to deplete Rv2639c/MT2717 under various stress conditions relevant to infection

  • Complementation studies: Expressing Rv2639c/MT2717 or its orthologues from other mycobacterial species in a knockout strain to assess functional conservation

  • Reporter fusions: Creating translational fusions with reporter proteins to monitor expression patterns and subcellular localization under different conditions

  • Interaction screens: Performing systematic screens for protein-protein or protein-metabolite interactions to identify potential binding partners and functional associations

  • Phenotypic profiling: Comprehensive phenotypic characterization of mutant strains under diverse growth conditions and stress scenarios

What role might Rv2639c/MT2717 play in M. tuberculosis pathogenesis?

While direct evidence for Rv2639c/MT2717's role in pathogenesis is lacking in the provided search results, its nature as a conserved membrane protein suggests potential involvement in:

  • Host-pathogen interactions: Many membrane proteins mediate direct contact with host cells or recognition of host factors

  • Adaptation to the intracellular environment: Membrane proteins often sense environmental changes and transmit signals to adapt bacterial physiology

  • Nutrient acquisition: Transport systems are critical for survival in the nutrient-restricted environment of the macrophage

  • Drug resistance: Membrane proteins can contribute to intrinsic drug resistance by limiting permeability or functioning as efflux pumps

Studies of M. tuberculosis pathogenesis have revealed complex lifecycle transitions between acute, chronic, and latent infection phases . Investigating Rv2639c/MT2717 expression and function across these phases could provide insights into its potential contribution to disease progression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.