Recombinant UPF0060 membrane protein XOO1791 (XOO1791)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
XOO1791; UPF0060 membrane protein XOO1791
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-112
Protein Length
full length protein
Species
Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Target Names
XOO1791
Target Protein Sequence
MNLAPTTLLLFAATALAELVGCYLPYLWLRNGGSVWLLLPTALRLASFVWLLSLHPDASG RVYAAYGGVYIASALGLWLWWVDGVTPTRWDLLGAVCCLFGMAIIMFAPRSA
Uniprot No.

Target Background

Database Links

KEGG: xoo:XOO1791

Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0060 membrane protein XOO1791 and what organism does it originate from?

UPF0060 membrane protein XOO1791 is a small integral membrane protein derived from the plant pathogen Xanthomonas oryzae pv. oryzae. According to UniProt database (Q5H1X6), this protein consists of 112 amino acids with a characteristic transmembrane structure . The protein belongs to the UPF0060 family (Uncharacterized Protein Family 0060), representing a group of membrane proteins with conserved structural features but largely undetermined functions. XOO1791 contains hydrophobic regions typical of integral membrane proteins and likely plays a role in the membrane biology of Xanthomonas oryzae, though its precise biological function requires further characterization through targeted functional studies .

How can researchers monitor the expression efficiency of recombinant XOO1791?

Monitoring expression efficiency of XOO1791 requires specialized approaches due to its membrane protein nature. The following methodological workflow is recommended:

  • GFP fusion monitoring: Creating an N-terminal fusion with fluorescent proteins (preferably mNeonGreen) allows real-time monitoring of expression and proper membrane localization through fluorescence microscopy or plate reader measurements .

  • Western blot analysis with epitope tags: Quantitative western blotting using anti-His or anti-FLAG antibodies against the fusion tag. Quantification can be performed using standard curves with known concentrations of reference proteins (300-600 nM yields are typically achieved for small membrane proteins in optimized systems) .

  • Small-scale purification trials: Performing mini-purifications from 5-10 mL cultures can provide quantitative data on expression yields prior to scale-up .

A combination of these approaches provides comprehensive monitoring of both expression quantity and protein quality throughout the expression optimization process.

What is the optimal purification strategy for recombinant XOO1791?

Purification of the recombinant UPF0060 membrane protein XOO1791 requires a careful multi-step approach to maintain protein integrity while achieving high purity. Based on established membrane protein purification protocols, the following optimized workflow is recommended:

  • Membrane isolation and enrichment:

    • Harvest cells and disrupt by sonication or mechanical methods in buffer containing protease inhibitors

    • Remove unbroken cells and debris by low-speed centrifugation (10,000×g, 20 min)

    • Isolate membrane fraction by ultracentrifugation (100,000×g, 1 hour)

    • Collect enriched membranes by ultracentrifugation

  • Solubilization optimization:

    • Screen detergents for optimal solubilization (typically 1% DDM, LDAO, or 0.5% LMNG)

    • Incubate membranes with selected detergent for 1-2 hours at 4°C with gentle agitation

    • Remove insoluble material by ultracentrifugation (100,000×g, 30 min)

  • Affinity chromatography:

    • Apply solubilized sample to Ni-NTA resin (for His-tagged XOO1791)

    • Wash with 20-50 mM imidazole to remove non-specific binding

    • Elute with 250-300 mM imidazole buffer containing 0.05-0.1% detergent

  • Size exclusion chromatography:

    • Apply eluted protein to appropriate SEC column (Superdex 200 or similar)

    • Collect monodisperse peak fractions

    • Analyze purity by SDS-PAGE (target >90% purity)

This purification strategy typically yields 1-2 mg of purified XOO1791 per liter of bacterial culture with >90% purity when optimized correctly.

How should researchers address aggregation issues when working with purified XOO1791?

Aggregation is a common challenge when working with membrane proteins like XOO1791. A systematic troubleshooting approach should be implemented:

  • Detergent optimization: Screen multiple detergent types and concentrations to identify conditions that maintain XOO1791 in a monodisperse state. Consider starting with the following detergent panel:

    DetergentWorking ConcentrationCMC (mM)Properties
    DDM0.05-0.1%0.17Mild, widely used
    LDAO0.05-0.1%1-2Harsh but effective
    LMNG0.01-0.05%0.01Stabilizing for many MPs
    Digitonin0.1-0.5%~0.5Very mild, native-like
  • Buffer optimization: Systematically test:

    • pH range (typically 7.0-8.0)

    • Salt concentration (150-500 mM NaCl)

    • Glycerol addition (10-20%)

    • Specific lipid supplementation (0.01-0.05 mg/mL E. coli lipid extract)

  • Alternative stabilization approaches:

    • Reconstitution into nanodiscs or lipid bicelles

    • Addition of specific binding partners or substrates

    • Use of thermostabilizing mutations if function permits

  • Analytical assessment of aggregation:

    • Dynamic light scattering to monitor particle size distribution

    • SEC-MALS (multi-angle light scattering) to determine absolute molecular weight and oligomeric state

    • Negative-stain EM to visualize protein homogeneity

Researchers should systematically document these optimization efforts, as conditions that successfully prevent XOO1791 aggregation will likely be critical for downstream structural and functional studies.

What analytical methods are most appropriate for confirming the structural integrity of purified XOO1791?

To confirm the structural integrity of purified XOO1791, researchers should employ multiple complementary analytical techniques:

  • Circular Dichroism (CD) Spectroscopy:

    • Measure far-UV CD spectra (190-260 nm) to assess secondary structure content

    • Expected results for intact XOO1791: characteristic α-helical pattern with minima at 208 and 222 nm

    • Compare with denatured controls to establish baseline differences

  • Fluorescence Spectroscopy:

    • Intrinsic tryptophan fluorescence to monitor tertiary structure (excitation at 280 nm, emission scanning 300-400 nm)

    • Shifts in emission maxima indicate changes in the local environment of aromatic residues

  • Thermal Stability Assessment:

    • Differential scanning fluorimetry using SYPRO Orange or similar dyes

    • Thermostable proteins typically show melting temperatures (Tm) >45°C

    • Multiple transitions may indicate domain unfolding

  • Protease Susceptibility:

    • Limited proteolysis with trypsin or chymotrypsin at varied enzyme:protein ratios

    • Analyze digestion patterns by SDS-PAGE

    • Well-folded membrane proteins show resistance to complete digestion

  • SEC-MALS Analysis:

    • Provides absolute molecular weight determination independent of shape

    • Confirms proper oligomeric state

    • Monodisperse peak indicates homogeneous protein population

For membrane proteins specifically, additional validation can be performed by reconstituting the purified protein into liposomes or nanodiscs and assessing membrane integration through:

  • Flotation assays in density gradients

  • Protease protection assays to verify proper orientation

  • Freeze-fracture electron microscopy to visualize membrane-embedded particles

What are the established methods for investigating XOO1791 function in experimental systems?

Despite being part of the uncharacterized protein family (UPF0060), several methodological approaches can be employed to investigate XOO1791 function:

  • Genetic context analysis:

    • Examine genomic neighborhood of xoo1791 gene for functional associations

    • Identify conserved operons or gene clusters across bacterial species

    • Apply guilt-by-association principles to predict potential functions

  • Phenotypic analysis of knockout/overexpression strains:

    • Generate xoo1791 deletion mutants in Xanthomonas oryzae

    • Perform complementation studies with recombinant protein

    • Assess changes in growth rates, membrane integrity, and virulence in plant models

    • Compare phenotypes under various stress conditions (osmotic, pH, antibiotic challenge)

  • Protein-protein interaction studies:

    • Bacterial two-hybrid screening to identify interaction partners

    • Co-immunoprecipitation with tagged XOO1791 followed by mass spectrometry

    • Crosslinking mass spectrometry to identify spatial relationships with other membrane components

  • Lipid interaction analysis:

    • Liposome binding assays with purified XOO1791

    • Fluorescence anisotropy measurements with labeled lipids

    • Monitoring changes in liposome permeability in the presence of XOO1791

  • Functional reconstitution:

    • Incorporate purified XOO1791 into proteoliposomes

    • Perform transport assays with various substrates (ions, small molecules)

    • Measure changes in membrane potential or pH using fluorescent indicators

These approaches can be implemented systematically to develop hypotheses about XOO1791 function that can then be tested with more targeted experiments.

How can researchers design experiments to determine if XOO1791 functions as a transporter or channel?

To investigate potential transporter or channel functionality of XOO1791, researchers should implement a systematic experimental workflow:

  • Bioinformatic prediction:

    • Analyze transmembrane topology using TMHMM, TOPCONS, or MEMSAT

    • Search for conserved transport-related motifs or structural features

    • Compare with characterized transporters in the same family or fold

  • Electrophysiological characterization:

    • Reconstitute purified XOO1791 into planar lipid bilayers

    • Perform voltage-clamp recordings under various ionic conditions

    • Analyze single-channel conductance and ion selectivity through current-voltage relationships

    • Test channel blockers or inhibitors to confirm specificity

  • Transport assays in reconstituted systems:

    • Prepare XOO1791-containing proteoliposomes with entrapped fluorescent indicators

    • Test for transport of various substrates (ions, sugars, amino acids)

    • Monitor concentration-dependent transport kinetics

  • Flux assays in cellular systems:

    • Express XOO1791 in transport-deficient bacterial strains

    • Measure uptake of radiolabeled or fluorescent substrates

    • Compare transport rates with positive and negative controls

    • Determine transport kinetics (Km and Vmax values)

  • Structural analysis focused on transport function:

    • Identify potential substrate binding sites through computational docking

    • Create point mutations in predicted functional residues

    • Assess impact of mutations on transport activity

    • Perform structure-function correlation studies

By integrating these approaches, researchers can systematically characterize the transport properties of XOO1791 and determine its substrate specificity and mechanism of action.

What is the current understanding of XOO1791's role in bacterial virulence or stress response?

The role of XOO1791 in bacterial virulence or stress response remains largely unexplored, presenting an important research opportunity. Based on analysis of related bacterial membrane proteins, several methodological approaches can help elucidate its potential functions:

  • Comparative genomic analysis:

    • XOO1791 belongs to the UPF0060 family, conserved across various bacterial species

    • Presence in plant pathogens suggests potential roles in host-pathogen interactions

    • Gene neighborhood analysis may reveal functional associations with virulence factors

  • Expression profiling under stress conditions:

    • qRT-PCR or RNA-seq analysis of xoo1791 expression during:

      • Plant infection process

      • Exposure to plant defense compounds

      • Osmotic, oxidative, or pH stress

      • Nutrient limitation

    • Significant upregulation under specific conditions would suggest functional relevance

  • Phenotypic characterization of mutant strains:

    • Growth curve analysis under various stress conditions

    • Biofilm formation capacity

    • Motility assays

    • Resistance to antimicrobial compounds

  • Interaction with host immune system:

    • Assess whether XOO1791 interacts with plant pattern recognition receptors

    • Test if XOO1791 elicits plant defense responses

    • Evaluate potential roles in evading plant immunity

While direct evidence for XOO1791's role in virulence is currently limited, its membrane localization and conservation across bacterial pathogens warrant investigation into potential functions in bacterial adaptation to host environments or stress conditions.

What structural determination methods are most suitable for XOO1791?

Determining the structure of membrane proteins like XOO1791 presents unique challenges requiring specialized methodological approaches. Based on current structural biology advancements, the following methods are recommended for XOO1791:

  • X-ray Crystallography:

    • Traditional approach but challenging for membrane proteins

    • For XOO1791, consider:

      • Lipidic cubic phase (LCP) crystallization

      • Fusion with crystallization chaperones (e.g., T4 lysozyme)

      • Antibody fragment co-crystallization to increase hydrophilic surface area

    • Resolution potential: 1.5-3.0 Å with well-diffracting crystals

    • Limitations: Crystal packing may distort native conformation

  • Cryo-Electron Microscopy (cryo-EM):

    • Increasingly powerful for membrane proteins

    • For small proteins like XOO1791 (12 kDa), consider:

      • Reconstitution in membrane protein-enriched extracellular vesicles (MPEEVs)

      • Analysis by cryo-electron tomography with subtomogram averaging

      • Multimerization strategies to increase effective molecular weight

    • Resolution potential: 3-4 Å for well-behaved samples

    • Advantages: Native-like lipid environment maintenance

  • Solution/Solid-State NMR:

    • Particularly valuable for dynamic regions and smaller membrane proteins

    • For XOO1791, consider:

      • Solution NMR with detergent micelles or nanodiscs (feasible for 12 kDa protein)

      • ¹⁵N/¹³C isotopic labeling through expression in minimal media

      • TROSY-based experiments to improve spectral quality

    • Resolution potential: Atomic resolution for well-structured regions

    • Advantages: Dynamic information, native-like conditions

  • Integrated Structural Biology Approach:

The most practical initial approach would be solution NMR given XOO1791's small size (112 amino acids), with cryo-EM in native membrane vesicles as a complementary method to capture the protein in its native lipid environment.

How can researchers optimize sample preparation for structural studies of XOO1791?

Optimizing sample preparation is critical for successful structural studies of membrane proteins like XOO1791. The following comprehensive methodological workflow addresses key considerations:

  • Construct optimization:

    • Create multiple constructs with varied N/C-terminal boundaries

    • Consider removal of flexible regions (if known)

    • Incorporate tags strategically with protease cleavage sites

    • Screen fusion partners that enhance stability (e.g., SUMO, MBP)

  • Expression screening:

    • Test multiple expression conditions in parallel:

      • Temperature (16°C, 25°C, 30°C, 37°C)

      • Induction methods (IPTG concentration: 0.1-1.0 mM)

      • Media composition (LB, TB, minimal media for isotope labeling)

      • Duration (4h, 8h, overnight)

    • Use GFP fusion for rapid assessment of expression and membrane integration

  • Detergent optimization for extraction:

    • Screen detergent panel using FSEC to assess protein stability and monodispersity:

    Detergent ClassExamplesRecommended Concentration
    MaltosidesDDM, UDM, DM1-2% extraction, 0.05-0.2% purification
    GlucosidesOG, NG1-2% extraction, 0.5-1.0% purification
    Neopentyl glycolsLMNG, DMNG0.5-1.0% extraction, 0.01-0.05% purification
    Fos-cholinesFC-12, FC-141-2% extraction, 0.1-0.5% purification
  • Purification optimization:

    • Multi-step purification with minimal detergent exchanges

    • Consider on-column detergent exchange during affinity purification

    • Implement SEC as final polishing step

    • Optimize buffer components:

      • pH screening (typically 6.5-8.0)

      • Salt type and concentration (100-500 mM)

      • Stabilizing additives (glycerol 5-10%, specific lipids)

  • Alternative membrane-mimetic environments:

    • For XOO1791, consider reconstitution into:

      • Nanodiscs with MSP1D1 (optimal for ~8-12 nm diameter discs)

      • Amphipols (A8-35)

      • SMALPs (styrene-maleic acid lipid particles)

      • Bicelles (DMPC/CHAPSO mixtures)

    • Validate functional integrity after reconstitution

  • Sample homogeneity assessment:

    • Multi-detection SEC (UV, fluorescence, light scattering)

    • Negative-stain EM to confirm monodispersity

    • Thermal stability assays to identify optimal buffer conditions

By systematically optimizing these parameters, researchers can significantly improve the probability of obtaining high-quality structural data for XOO1791.

How can computational methods complement experimental approaches in studying XOO1791 structure-function relationships?

Computational methods provide powerful tools to complement experimental studies of XOO1791, particularly when structural data may be limited or challenging to obtain. A comprehensive computational strategy should include:

  • Homology modeling and threading approaches:

    • Generate preliminary structural models using:

      • I-TASSER, SWISS-MODEL, or AlphaFold2

      • Templates from structurally characterized UPF0060 family members

      • Secondary structure predictions to guide modeling

    • Validate models with:

      • Ramachandran plot analysis

      • Verification of transmembrane topology

      • DOPE/QMEAN scoring functions

  • Molecular dynamics simulations:

    • Embed XOO1791 models in explicit lipid bilayers

    • Run extended simulations (>100 ns) to assess stability

    • Coarse-grained simulations for longer timescale events

  • Binding site prediction and ligand docking:

    • Identify potential binding pockets using:

      • CASTp, PASS, or SiteMap algorithms

      • Conservation analysis across homologs

    • Perform virtual screening against:

      • Metabolite libraries

      • Signaling molecules

      • Plant defense compounds

    • Validate top hits experimentally

  • Electrostatic and lipid interaction analysis:

    • Calculate electrostatic potential maps to identify charged surfaces

    • Predict protein-lipid interactions using:

      • PPM server

      • PLATINUM

      • CG simulations with different lipid compositions

  • Network analysis and evolutionary coupling:

    • Identify co-evolving residues using:

      • Direct Coupling Analysis (DCA)

      • Evolutionary Trace methods

    • Predict functionally important residues from conservation patterns

    • Generate hypothesis-driven mutations for experimental validation

  • Integrative modeling approaches:

    • Combine computational models with experimental constraints:

      • Low-resolution EM maps

      • Cross-linking mass spectrometry data

      • EPR distance measurements

      • Hydrogen-deuterium exchange data

These computational approaches provide a framework for developing testable hypotheses about XOO1791 structure-function relationships, guiding experimental design, and interpreting experimental results within a mechanistic context.

How can XOO1791 research contribute to understanding bacterial membrane biology?

XOO1791 research offers unique opportunities to advance our understanding of bacterial membrane biology through several avenues:

  • Membrane protein evolution in plant pathogens:

    • XOO1791 belongs to the UPF0060 family, conserved across bacterial species

    • Comparative analysis across Xanthomonas species and other plant pathogens can reveal:

      • Evolutionary conservation patterns suggesting essential functions

      • Species-specific adaptations related to host specificity

      • Horizontal gene transfer events shaping membrane protein repertoires

  • Membrane organization and microdomains:

    • XOO1791 can serve as a model for studying:

      • Protein distribution within bacterial membranes

      • Formation of functional membrane microdomains

      • Lipid-protein interactions in bacterial membranes

  • Contribution to membrane protein biogenesis understanding:

    • As a small membrane protein, XOO1791 provides an excellent model to study:

      • Membrane insertion pathways (Sec vs. YidC-dependent)

      • Topogenesis determinants

      • Quality control mechanisms for membrane proteins

    • In vivo folding studies can be performed using:

      • Split GFP complementation assays

      • Accessibility mapping with cysteine labeling

      • Ribosome profiling during membrane protein synthesis

  • Methodological advancements:

    • XOO1791 can serve as a model system for developing:

      • Improved membrane protein expression strategies

      • Novel solubilization and purification approaches

      • Advanced structural biology methods for small membrane proteins

      • Cell-free expression systems optimized for membrane proteins

By focusing on these aspects, XOO1791 research can contribute fundamental insights into bacterial membrane biology with potential implications for understanding bacterial adaptation, pathogenesis, and the development of new antimicrobial strategies.

What are the potential implications of XOO1791 research for developing new antimicrobial strategies?

XOO1791 research could contribute to novel antimicrobial strategies through several mechanistic pathways:

  • Target validation for small molecule inhibitors:

    • If XOO1791 proves essential for Xanthomonas oryzae virulence or survival, it becomes a candidate for targeted inhibition

    • Structure-based drug design could be employed once high-resolution structures are obtained

    • Virtual screening against the identified binding sites could identify lead compounds

  • Immunization strategies:

    • If XOO1791 is surface-exposed, it could serve as an antigenic target

    • Recombinant XOO1791 could be evaluated as a potential subunit vaccine component

    • Based on findings with other outer membrane proteins, combination immunization strategies could offer enhanced protection:

    Protein CombinationImmune ResponseProtection LevelReference
    XOO1791 + OmpAEnhanced antibody titersPotentially improved
    XOO1791 + OmpCBroader epitope coverageCross-protection potential
    XOO1791 + BamAMultiple membrane targetsSynergistic protection
  • Bacterial physiology disruption:

    • Understanding XOO1791's role in membrane integrity could reveal vulnerabilities

    • If involved in stress response, targeting XOO1791 could sensitize bacteria to other antimicrobials

    • Potential for developing adjuvant therapies that enhance conventional antibiotic efficacy

  • Host-pathogen interaction targeting:

    • If XOO1791 plays a role in host interaction, blocking this function could attenuate virulence

    • Peptide inhibitors mimicking interaction interfaces could disrupt pathogenesis

    • Small molecule inhibitors of protein-protein interactions could be developed

  • Cross-species application potential:

    • Conservation analysis across bacterial species could reveal whether XOO1791-targeting approaches might have broad-spectrum potential

    • Comparative structural analysis with homologs in other pathogens could guide development of pan-species inhibitors

The translational potential of XOO1791 research depends on elucidating its precise function and essentiality in bacterial survival and virulence, highlighting the importance of fundamental characterization studies.

What emerging technologies might enhance future studies of XOO1791 and similar membrane proteins?

Several cutting-edge technologies are poised to revolutionize research on small membrane proteins like XOO1791:

  • Advanced structural biology methods:

    • Microcrystal electron diffraction (MicroED) for structure determination from nano/microcrystals

    • Time-resolved serial crystallography at X-ray free-electron lasers (XFELs)

    • Integrative structural biology combining multiple data sources

  • Innovative membrane mimetics:

    • Next-generation nanodiscs with tunable properties

    • Cell-derived native nanodiscs preserving lipid composition

    • 3D-printed artificial membranes with defined composition

    • Lipid cubic phase technologies for functional studies

    • Membrane protein-enriched extracellular vesicles (MPEEVs) for native environment maintenance

  • Advanced imaging technologies:

    • Super-resolution microscopy for in vivo localization studies:

      • PALM/STORM for nanometer-scale resolution

      • Expansion microscopy for enhanced visualization

    • Correlative light and electron microscopy (CLEM)

    • Atomic force microscopy for topographical and mechanical studies

    • High-speed atomic force microscopy for dynamic measurements

  • AI and computational advancements:

    • AI-driven protein structure prediction (AlphaFold2, RoseTTAFold)

    • Machine learning approaches for:

      • Optimizing expression conditions

      • Predicting membrane protein stability

      • Identifying functional residues

    • Enhanced molecular dynamics simulations:

      • GPU-accelerated simulations reaching millisecond timescales

      • Enhanced sampling methods for rare events

      • Polarizable force fields for more accurate electrostatics

  • Cell-free and high-throughput systems:

    • Advanced cell-free expression systems optimized for membrane proteins

    • Microfluidic platforms for parallel screening of conditions

    • Droplet-based assays for functional characterization

    • High-throughput cryo-EM sample preparation and screening

    • Automated pipeline integration from expression to structure

  • Single-molecule technologies:

    • Optical tweezers for measuring membrane protein folding energetics

    • Single-molecule FRET for conformational dynamics

    • Nanopore-based electrical recordings

    • Single-molecule tracking in native membranes

These emerging technologies will enable researchers to study XOO1791 with unprecedented detail, addressing longstanding challenges in membrane protein research and opening new avenues for structural and functional characterization.

What are the most critical experimental controls when working with XOO1791?

Robust experimental design for XOO1791 research requires careful implementation of specific controls to ensure valid and reproducible results:

  • Expression and purification controls:

    • Empty vector controls to assess background expression

    • Non-membrane protein controls (e.g., GFP alone) to validate membrane fractionation

    • Untagged protein controls to assess tag interference

    • Denatured protein controls to confirm functional assay specificity

    • Time-course sampling to monitor protein stability

    • Batch-to-batch consistency checks with reference standards

  • Structural integrity controls:

    • CD spectroscopy before and after each experimental manipulation

    • Thermostability assays at experimental temperatures

    • SEC profiles to confirm monodispersity is maintained

    • Detergent-only controls in all biophysical measurements

    • Native vs. denatured protein comparisons for spectroscopic methods

  • Functional assay controls:

    • Positive controls with well-characterized membrane proteins

    • Inactive mutant controls (if functional residues are known)

    • Detergent/lipid-only controls to assess background signals

    • Temperature controls to distinguish active transport from passive diffusion

    • Concentration gradients to confirm directionality of effects

  • Biological relevance controls:

    • Wild-type strain comparisons in all phenotypic assays

    • Complementation controls in genetic studies

    • Related bacterial species controls to assess conservation of function

    • Host response controls in pathogenesis studies

    • Environmental condition controls (pH, temperature, osmolarity)

  • Technical and procedural controls:

    • Protease inhibitor controls in all preparations

    • Endotoxin testing for immunological studies

    • Sterility controls for long-term experiments

    • Instrument calibration standards for quantitative measurements

    • Inter-laboratory validation for critical findings

Implementing these controls systematically will ensure that experimental observations related to XOO1791 are specific, reproducible, and biologically meaningful.

How should researchers approach troubleshooting expression and purification issues specific to XOO1791?

When encountering challenges with XOO1791 expression and purification, a systematic troubleshooting approach is essential:

  • Low expression yields:

    • Solution strategies:

      • Optimize codon usage for E. coli

      • Test alternative promoters (trc, ara) for lower expression rates

      • Reduce cultivation temperature (16-25°C)

      • Co-express with chaperones (GroEL/ES, DnaK/J)

      • Consider fusion partners (MBP, SUMO) to enhance stability

  • Protein misfolding/inclusion bodies:

    • Solution strategies:

      • Slow down expression rate with lower inducer concentrations

      • Add membrane-promoting additives (glycerol 5-10%)

      • Test alternative solubilization methods from inclusion bodies:

        • Mild detergents (LDAO, DDM)

        • On-column refolding during purification

        • Stepwise urea gradient removal

  • Poor solubilization efficiency:

    • Solution strategies:

      • Optimize solubilization buffer (pH, salt concentration)

      • Add specific lipids (E. coli total lipid extract, 0.01-0.1 mg/mL)

      • Consider harsher detergents initially, followed by exchange to milder ones

      • Try alternative solubilization methods (SMA polymers)

  • Protein instability during purification:

    • Solution strategies:

      • Add stabilizing additives (glycerol, specific lipids, cholesterol)

      • Maintain minimum CMC of detergent throughout purification

      • Reduce purification steps and handling time

      • Consider on-column detergent exchange during affinity purification

      • Explore nanodiscs or amphipol reconstitution for enhanced stability

  • Low purity or contamination:

    • Solution strategies:

      • Optimize imidazole concentration in wash buffers

      • Add secondary purification steps (ion exchange, SEC)

      • Consider on-column cleavage of fusion tags

      • Test alternative affinity systems (Strep-tag, FLAG-tag)

By systematically applying these troubleshooting strategies, researchers can overcome common challenges encountered with XOO1791 expression and purification.

What practical recommendations exist for designing collaborative research projects involving XOO1791?

Designing successful collaborative research projects centered on XOO1791 requires thoughtful planning and coordination across multiple disciplines:

  • Establishing complementary expertise teams:

    • Core expertise areas to include:

      • Molecular biology/protein biochemistry for expression and purification

      • Structural biology for 3D characterization

      • Computational biology for modeling and simulation

      • Microbiology for functional and phenotypic analysis

      • Plant pathology for host-pathogen interaction studies

    • Create a skills matrix to identify gaps and redundancies across collaborators

  • Material sharing and standardization:

    • Establish material transfer agreements early

    • Create centralized plasmid and strain repositories

    • Implement consistent batch numbering and documentation

  • Data management and integration:

    • Utilize electronic lab notebooks with defined metadata standards

    • Establish shared data repositories with appropriate permissions

    • Implement version control for protocols and analysis scripts

    • Create integrated databases linking:

      • Sequence information

      • Expression constructs

      • Purification outcomes

      • Structural data

      • Functional assay results

  • Milestone planning and project management:

    • Design parallel workflows to maximize efficiency:

    TeamInitial PhaseMiddle PhaseFinal Phase
    Molecular BiologyConstruct optimizationLarge-scale expressionMutant generation
    BiochemistryPurification optimizationFunctional assaysInteraction studies
    Structural BiologyCondition screeningData collectionStructure determination
    ComputationalHomology modelingMD simulationsStructure-function prediction
    MicrobiologyKnockout generationPhenotypic analysisIn vivo validation
  • Communication and knowledge exchange:

    • Schedule regular cross-disciplinary meetings

    • Implement progress tracking systems

    • Organize hands-on training workshops for technical knowledge transfer

    • Create standardized reporting templates

    • Establish troubleshooting committees for technical challenges

  • Publication and intellectual property strategy:

    • Agree on authorship guidelines early

    • Plan complementary publications highlighting different aspects

    • Develop IP protection strategy before public disclosure

    • Coordinate conference presentations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.