Recombinant UPF0073 membrane protein Mb1114c (Mb1114c)

Shipped with Ice Packs
In Stock

Description

Production System

Mb1114c is synthesized in E. coli using in vitro expression systems, leveraging the organism’s rapid growth, genetic tractability, and cost-effectiveness . Key steps include:

  1. Cloning: The gene encoding Mb1114c is inserted into a plasmid vector under a T7 or other inducible promoter.

  2. Expression: Cultures are induced with IPTG, allowing high-density growth and protein production .

  3. Harvesting: Cells are lysed, and inclusion bodies are solubilized using detergents (e.g., Triton X-100) or denaturants (e.g., urea) .

Purification

The His-tagged protein is purified via immobilized metal affinity chromatography (IMAC), yielding >90% purity as confirmed by SDS-PAGE .

Table 2: Production System Comparison

Host SystemAdvantagesLimitationsRelevance to Mb1114c
E. coliHigh yield, low cost, rapid growth Lack of eukaryotic PTMs Primary source
Insect CellsNative PTMs, proper folding Complex handling, higher cost Not used for Mb1114c
Mammalian CellsComplex PTMs, human-like folding Low yield, high cost Not reported

For Mb1114c, E. coli remains optimal due to its simplicity and cost-effectiveness, though insect cells may be considered if post-translational modifications (PTMs) are critical .

Research Gaps and Future Directions

  1. Functional characterization: Despite structural studies, the biological role of Mb1114c remains unclear.

  2. Interaction mapping: Proteomic approaches could identify binding partners or substrates.

  3. Therapeutic potential: Hypothetical applications in tuberculosis diagnostics or drug development require validation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
BQ2027_MB1114C; UPF0073 membrane protein Mb1114c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-242
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB1114C
Target Protein Sequence
MSGQADTATTAEARTPAHAAHHLVEGVARVLTKPRFRGWIHVYSAGTAVLAGASLVAVSW AVGSAKAGLTTLAYTAATITMFTVSATYHRVNWKSATARNWMKRADHSMIFVFIAGSYTP FALLALPAHDGRVVLSIVWGGAIAGILLKMCWPAAPRSVGVPLYLLLGWVAVWYTATILH NAGVTALVLLFVGGALYSIGGILYAVRWPDPWPTTFGYHEFFHACTAVAAICHYIAMWFV VF
Uniprot No.

Target Background

Protein Families
UPF0073 (Hly-III) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0073 membrane protein Mb1114c and what organism does it originate from?

UPF0073 membrane protein Mb1114c is a transmembrane protein from Mycobacterium bovis with Uniprot accession number P67158. It belongs to the UPF (Uncharacterized Protein Family) classification, indicating that its precise biological function has not been fully characterized . As a membrane protein, it is embedded within the cellular membrane and likely plays a role in cellular processes such as transport, signaling, or structural support within the bacterium.

What are the recommended storage and handling conditions for recombinant UPF0073 membrane protein Mb1114c?

For optimal stability and activity, recombinant UPF0073 membrane protein Mb1114c should be stored according to the following guidelines:

Storage PurposeTemperatureDuration
Standard storage-20°CShort to medium term
Extended storage-80°CLong term
Working aliquots4°CUp to one week

The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for maintaining protein stability . It is critical to avoid repeated freeze-thaw cycles as they can lead to protein denaturation and loss of activity. For laboratory work, it is recommended to prepare single-use aliquots to minimize freeze-thaw damage.

What experimental design approaches are most suitable for studying UPF0073 membrane protein Mb1114c?

When designing experiments to study UPF0073 membrane protein Mb1114c, researchers should implement a systematic approach that considers the membrane-bound nature of the protein:

  • True experimental design with proper controls: Implement control and experimental groups with random assignment to minimize bias . This is particularly important when testing factors affecting protein expression, purification efficiency, or functional characteristics.

  • Variable definition and hypothesis formulation: Clearly define independent variables (e.g., expression conditions, buffer compositions) and dependent variables (e.g., protein yield, stability, activity) . For example:

    Research QuestionIndependent VariableDependent Variable
    Effect of temperature on protein stabilityIncubation temperatureProtein half-life
    Impact of detergent type on purificationDetergent compositionProtein yield and purity
  • Systematic control of extraneous variables: Identify and control variables that might confound results, such as bacterial strain variations, media composition, or induction timing .

  • Between-subjects or within-subjects designs: Choose appropriate design based on whether comparing different preparation methods (between-subjects) or tracking changes in the same protein sample over time (within-subjects) .

What protein production and purification strategies yield optimal results for UPF0073 membrane protein?

Based on established methods for membrane protein production and purification, the following strategies are recommended:

  • Expression system selection: While E. coli is commonly used for recombinant protein expression, eukaryotic expression systems such as Saccharomyces cerevisiae may provide advantages for membrane proteins due to their ability to perform post-translational modifications and provide a eukaryotic membrane environment .

  • Expression optimization:

    • Use strains specifically designed for membrane protein expression

    • Optimize induction conditions (temperature, inducer concentration, duration)

    • Consider fusion tags that enhance expression and solubility

  • Extraction and solubilization:

    • Select appropriate detergents for membrane protein extraction

    • Screen multiple detergent types at various concentrations

    • Consider alternative solubilization approaches such as amphipols or nanodiscs

  • Purification workflow:

    • Implement multi-step purification starting with affinity chromatography

    • Include size-exclusion chromatography to assess homogeneity and oligomeric state

    • Validate sample monodispersity using complementary techniques such as dynamic light scattering

How can high-throughput screening methods be utilized to optimize UPF0073 membrane protein Mb1114c expression?

High-throughput approaches can significantly accelerate optimization of membrane protein expression:

  • GFP fusion screening: Fusing Green Fluorescent Protein (GFP) to UPF0073 membrane protein Mb1114c allows direct measurement of expression levels without purification . The fluorescence intensity correlates with correctly folded protein, providing a rapid readout of expression success.

  • Fluorescence-detection size-exclusion chromatography (FSEC): This technique combines the benefits of GFP fusion with size-exclusion chromatography to simultaneously assess both expression levels and sample homogeneity . The workflow involves:

    • Creating GFP-tagged constructs of UPF0073 membrane protein Mb1114c

    • Small-scale expression in different conditions

    • Sample preparation with selected detergents

    • FSEC analysis to identify conditions yielding monodisperse, well-expressed protein

  • Parallel mutation screening: For membrane proteins like UPF0073 Mb1114c, creating libraries of constructs with variations in:

    • N-terminal and C-terminal truncations

    • Loop modifications

    • Surface-exposed residue mutations

    These libraries can be screened in parallel to identify constructs with improved expression and stability characteristics .

How can data contradictions be identified and resolved when analyzing UPF0073 membrane protein Mb1114c?

When working with complex membrane proteins like UPF0073 Mb1114c, contradictory data may arise from multiple sources. A systematic approach to identifying and resolving these contradictions includes:

  • Formal contradiction notation: Implement a structured notation system using parameters such as:

    • α: number of interdependent data items

    • β: number of contradictory dependencies identified

    • θ: minimal number of Boolean rules needed to assess contradictions

  • Common contradiction sources in membrane protein research:

    • Discrepancies between different analytical techniques (e.g., circular dichroism vs. crystallography for structural assessment)

    • Batch-to-batch variation in protein preparation

    • Differential effects of detergents on protein conformation and activity

    • Contradictory functional assay results under different conditions

  • Resolution strategies:

    • Implement Boolean minimization approaches to simplify complex contradiction patterns

    • Use multiple orthogonal techniques to validate critical findings

    • Standardize protocols to minimize experimental variation

    • Document and report all experimental conditions comprehensively

What structural characterization methods are most appropriate for UPF0073 membrane protein Mb1114c?

Membrane proteins present unique challenges for structural characterization. For UPF0073 membrane protein Mb1114c, consider these approaches:

  • X-ray crystallography: Despite challenges in crystallizing membrane proteins, advances including lipidic cubic phase crystallization have made this technique viable . Requirements include:

    • Highly pure, homogeneous protein preparations

    • Screening of multiple crystallization conditions

    • Consideration of lipid/detergent compositions that maintain native-like environments

  • Nuclear Magnetic Resonance (NMR) spectroscopy: Depending on the size of UPF0073 membrane protein Mb1114c in its detergent micelle or other membrane mimetic:

    • Solution-state NMR for smaller complexes (<100 kDa)

    • Solid-state NMR for larger assemblies or reconstituted systems

    • TROSY (Transverse Relaxation Optimized Spectroscopy) approaches to improve spectral quality

  • Cryo-electron microscopy: Particularly valuable for membrane proteins that resist crystallization:

    • Single-particle analysis for structural determination

    • Does not require crystallization

    • Can visualize protein in various conformational states

  • Complementary techniques:

    • Circular dichroism for secondary structure assessment

    • Small-angle X-ray scattering for solution conformation

    • Hydrogen-deuterium exchange mass spectrometry for dynamics and solvent accessibility

How does UPF0073 membrane protein Mb1114c compare to other UPF membrane proteins?

UPF0073 membrane protein Mb1114c belongs to a broader category of uncharacterized protein families. Comparative analysis with other UPF membrane proteins reveals:

FeatureUPF0073 (Mb1114c)UPF0324 (SAS0317)
Source organismMycobacterium bovisStaphylococcus aureus
Molecular weight~26 kDa (estimated)35,754 Da
Sequence length242 amino acidsVariable (partial in available data)
Uniprot accessionP67158Q6GCD1
Predicted functionMembrane-associated, unknownPutative sulfate exporter family transporter

This comparison highlights the diversity within UPF membrane proteins and suggests potential areas for functional investigation . While both proteins are membrane-associated, their differences in size, organism origin, and predicted functions suggest they likely play distinct biological roles.

What are the emerging technologies that could advance research on UPF0073 membrane protein Mb1114c?

Several cutting-edge technologies show promise for advancing research on challenging membrane proteins like UPF0073 Mb1114c:

  • Free-electron laser X-ray crystallography: This technique allows diffraction data collection from micron or submicron-scale crystals, potentially overcoming the crystallization bottleneck for membrane proteins .

  • Single-particle cryo-electron microscopy: Continuing advances in detector technology and image processing algorithms are pushing resolution limits, making structural determination possible for increasingly smaller membrane proteins.

  • Integrative structural biology approaches: Combining multiple techniques (crystallography, NMR, cryo-EM, mass spectrometry, computational modeling) to build comprehensive structural models.

  • Advanced membrane mimetics:

    • Nanodiscs with tunable size and lipid composition

    • Lipidic cubic phase systems for crystallization and functional studies

    • Synthetic polymer alternatives to traditional detergents

  • High-throughput functional screening: Development of scalable assays to probe the biological function of UPF0073 membrane protein Mb1114c, potentially revealing its role in Mycobacterium bovis biology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.