Recombinant UPF0092 membrane protein YajC (yajC)

What is YajC protein and what are its structural characteristics?

YajC (UPF0092) is a conserved membrane protein found in various bacterial species. It consists of 110 amino acids in E. coli with the sequence: MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPKGTMKAL . This protein contains transmembrane domains that anchor it to the bacterial cell membrane. YajC is part of the SecDF-YajC complex, which functions in association with the SecYEG complex to form what is known as the holotranslocon or Sec system involved in protein translocation across membranes .

What is the function of YajC in bacterial systems?

YajC has been identified as a critical determinant in multiple cellular processes. Primarily, it functions as part of the Sec translocation system in bacteria, facilitating the movement of proteins across membranes. Research has demonstrated that YajC plays a significant role in biofilm formation in clinically relevant bacteria such as Enterococcus faecium . The protein appears to be involved in retaining cytoplasmic and cell surface-located proteins at the bacterial surface, which is crucial for initial cell adherence during biofilm development . In E. coli, YajC forms part of an integral membrane heterotrimeric complex with SecD and SecF, which interacts with YidC and is involved in the insertion of membrane proteins into the cytoplasmic membrane .

How is the yajC gene organized in bacterial genomes?

The yajC gene is typically found in an operon structure. In E. coli and many other bacteria, it is part of the secDF operon . The gene may be annotated under different names depending on the bacterial species. For instance, in E. coli, it is known as yajC (UniProt ID: P0ADZ9), while in Enterococcus faecium E1162, it is annotated as EfmE1162_0936 . The conservation of this gene across diverse bacterial species indicates its evolutionary importance in cellular functions.

How does YajC contribute to biofilm formation in pathogenic bacteria?

YajC has been identified as a crucial component in biofilm formation, particularly in clinically significant bacteria like Enterococcus faecium. Research utilizing microarray-based transposon mapping (M-TraM) identified yajC as a critical determinant of biofilm formation . The mechanism appears to involve YajC's role in retaining proteins at the bacterial cell surface.

When yajC is deleted (ΔyajC), significant decreases in biofilm biomass and thickness are observed compared to wild-type strains. This deficiency can be complemented by reintroducing a complete copy of yajC (ΔyajC+yajC) . The biofilm deficiency is observable in both semistatic and flow cell models, with the ΔyajC mutant showing reduced biofilm coverage and fewer dead cells in the biofilm structure .

The contribution of YajC to biofilm formation appears to involve initial cell adherence, as demonstrated by adherence assays in polystyrene plates. The ΔyajC mutant shows reduced attachment capability, particularly after washing with PBS, suggesting that proteins involved in initial adherence are more loosely attached to the cell surface in the absence of YajC .

What is the relationship between YajC and protein translocation?

YajC forms part of the Sec system (holotranslocon), an integral membrane complex involved in protein translocation across bacterial membranes. In E. coli, YajC is associated with SecD and SecF in a heterotrimeric complex (SecDF-YajC) that interacts with the SecYEG complex . This holotranslocon further interacts with YidC, an integral membrane protein involved in inserting membrane proteins into the cytoplasmic membrane .

Research has shown that cold-sensitive mutations in the SecDF-YajC complex can result in inactivation of protein translocation. These mutations yield an inactive complex, which leads to impaired in vitro protein translocation . This suggests that YajC plays a crucial role in maintaining the functionality of the Sec system, particularly under stress conditions like cold temperatures.

How does YajC affect the retention of surface proteins in bacteria?

YajC appears to play a significant role in retaining both cytoplasmic and cell surface proteins at the bacterial surface. Proteomic analysis of supernatants from wild-type and ΔyajC mutant strains reveals that certain proteins, including intracellular proteins like glyceraldehyde-3-phosphate dehydrogenase (GAPDH), elongation factor Tu, and ATP synthase, are present in higher quantities in the washed supernatant of ΔyajC compared to wild-type and complemented strains .

Confocal laser scanning microscopy confirms that these proteins are detected at the surface of wild-type and complemented strains but are less abundant on the surface of ΔyajC . This indicates that in the absence of YajC, the attachment of these proteins is altered, resulting in inadequate retention or capture at the bacterial surface. This altered protein retention mechanism likely contributes to the observed deficiency in biofilm formation in ΔyajC mutants.

How can recombinant YajC protein be effectively expressed and purified?

Recombinant YajC protein can be expressed using E. coli expression systems. Based on available protocols, the full-length UPF0092 membrane protein YajC (1-110 amino acids) can be expressed with an N-terminal His tag in E. coli . The expression construct typically includes the complete coding sequence of YajC with appropriate tags for purification.

For purification, the following methodological approach is recommended:

• Express the His-tagged YajC protein in E. coli under appropriate induction conditions

• Harvest cells and disrupt them to release the membrane-associated protein

• Solubilize membrane proteins using suitable detergents

• Purify using Ni-NTA or similar affinity chromatography leveraging the His tag

• Further purify using size exclusion chromatography if higher purity is required

• Confirm purity through SDS-PAGE (>90% purity is typically achievable)

• Lyophilize the purified protein or store in an appropriate buffer with glycerol

The purified protein should be stored at -20°C/-80°C, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles. Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (final concentration) for long-term storage .

What experimental approaches can be used to study YajC's role in biofilm formation?

Several experimental approaches have been documented for studying YajC's role in biofilm formation:

• Generation of yajC deletion mutants: Markerless deletion mutants can be created using techniques like allelic exchange. For E. faecium, this involves amplifying the flanking regions of yajC, followed by confirmation of the deletion by PCR .

• Complementation studies: In trans complementation can be achieved by introducing a complete copy of yajC on a vector into the deletion mutant. This validates that observed phenotypes are specifically due to the absence of YajC .

• Biofilm formation assays:

  • Semistatic model: Overnight bacterial cultures are diluted and added to coated coverslips in plates. After incubation, biofilms are washed, chemically fixed, and stained with propidium iodide. Analysis is performed using software like Comstat to measure thickness and biomass .

  • Flow cell model: This allows for the observation of biofilm development under continuous flow conditions, providing insights into the dynamics of biofilm formation over time .

• Initial adherence assays: Performed in 96-well polystyrene plates, these assays measure the attachment of bacterial cells to surfaces, with variations such as comparing unwashed and PBS-washed cells to assess the strength of attachment .

• Proteomic analysis: Analysis of supernatant proteomes using techniques like nano liquid chromatography MS/MS can identify proteins that are differentially released from wild-type versus mutant strains, providing insights into YajC's role in protein retention at the cell surface .

How can the interaction between YajC and other components of the Sec system be investigated?

Investigating the interactions between YajC and other components of the Sec system requires specialized techniques for membrane protein studies:

• Co-immunoprecipitation: Using antibodies against YajC or other Sec components to pull down protein complexes, followed by Western blotting or mass spectrometry to identify interacting partners.

• Bacterial two-hybrid systems: Adapted for membrane proteins, these systems can detect protein-protein interactions in vivo.

• Cross-linking studies: Chemical cross-linkers can be used to stabilize transient interactions between YajC and other Sec components before purification and analysis.

• Blue native PAGE: This technique preserves protein-protein interactions during electrophoresis and can be used to analyze native membrane protein complexes.

• Cryo-electron microscopy: For structural studies of the SecDF-YajC complex alone or in association with the SecYEG complex.

• Site-directed mutagenesis: Creating specific mutations in YajC can help identify residues crucial for interactions with other Sec components or for functionality.

• Genetic suppressor analysis: Identifying mutations in other genes that can suppress defects caused by yajC mutations can provide insights into functional relationships.

What key phenotypic differences are observed in YajC mutants compared to wild-type bacteria?

Based on experimental data, several significant phenotypic differences have been documented in YajC mutants:

These phenotypic differences highlight YajC's critical role in biofilm formation, particularly in the initial adherence phase, without affecting basic growth characteristics .

How do mutations in YajC affect protein translocation efficiency?

Cold-sensitive mutations in the SecDF-YajC complex have been shown to yield an inactive complex, resulting in impaired in vitro protein translocation . This suggests that YajC contributes to the efficiency and functionality of the Sec system, particularly under stress conditions.

The specific mechanisms by which YajC mutations affect translocation efficiency may involve:

• Altered interactions within the SecDF-YajC complex

• Disrupted association with the SecYEG complex

• Impaired interaction with YidC

• Changes in the energetics of protein translocation

• Reduced stability of the holotranslocon

Further research is needed to fully characterize the molecular mechanisms by which YajC mutations impact protein translocation under various conditions.

What proteins are differentially retained at the cell surface in the absence of YajC?

Proteomic analysis has identified several proteins that are differentially retained at the cell surface in the presence versus absence of YajC. In Enterococcus faecium, these include:

• Cytoplasmic proteins:

  • Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)

  • Elongation factor Tu

• Membrane-associated proteins:

  • ATP synthase

These proteins are found in higher quantities in the washed supernatant of ΔyajC mutants compared to wild-type and complemented strains, indicating that they are more loosely attached to the cell surface in the absence of YajC . Confocal microscopy confirms their reduced abundance on the surface of ΔyajC mutants.

This altered retention of surface proteins likely contributes to the deficiency in biofilm formation observed in ΔyajC mutants, particularly during the initial adherence phase.

What are the potential applications of YajC research in antimicrobial development?

Given YajC's critical role in biofilm formation in clinically relevant bacteria like Enterococcus faecium, it represents a potential target for novel antimicrobial strategies. Future research could explore:

• Development of small molecule inhibitors targeting YajC or its interactions with other Sec components

• Peptide-based approaches to disrupt YajC function or localization

• Antibody-based therapeutics targeting surface-exposed regions of YajC

• Anti-biofilm strategies specifically targeting YajC-dependent processes

• Combination therapies that target both YajC function and conventional antibiotic targets

Since biofilms contribute significantly to antimicrobial resistance and persistent infections, targeting YajC could potentially enhance the efficacy of existing antibiotics against biofilm-associated infections.

How might the function of YajC differ across bacterial species?

While YajC is conserved across many bacterial species, its specific functions may vary. Comparative genomic and functional studies could explore:

• Differences in YajC sequence and structure across diverse bacterial phyla

• Species-specific interaction partners of YajC

• Variations in the phenotypic effects of yajC deletion in different bacteria

• The relationship between YajC function and bacterial lifestyle (pathogenic vs. non-pathogenic)

• The evolutionary history of YajC and its role in bacterial adaptation

Understanding these differences could provide insights into the fundamental roles of YajC in bacterial physiology and potentially identify species-specific targeting strategies.

What advanced imaging techniques can reveal about YajC localization and dynamics?

Advanced imaging techniques could provide new insights into YajC function and dynamics:

• Super-resolution microscopy to visualize the nanoscale organization of YajC within the membrane

• Single-molecule tracking to analyze the mobility and clustering of YajC

• FRET-based approaches to study real-time interactions between YajC and other Sec components

• Correlative light and electron microscopy to link YajC localization with membrane ultrastructure

• Cryo-electron tomography to visualize YajC in the context of the native cell envelope

These approaches could reveal dynamic aspects of YajC function that are not accessible through biochemical or genetic approaches alone.