Recombinant UPF0114 protein in repA1-repA2 intergenic region

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
UPF0114 protein in repA1-repA2 intergenic region
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Thelaxes suberi
Target Protein Sequence
MEKRIANIIYSSRWLMFPVYIGLAFGFVLLTVKFFQQIICVIPEILTMSESGLVLIVLSL IDIALVGGLLVMVMFSGYENFIAKMETTENKKRLSWMGTMDVNSIKNKVASSIVAISSVH LLRLFMDADKISDNKIMWCVVIHLTFVLSAFGMAYIDKMSKKHYS
Uniprot No.

Target Background

Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0114 protein in repA1-repA2 intergenic region and where is it found?

UPF0114 protein is a protein encoded in the intergenic region between repA1 and repA2 genes in several Buchnera aphidicola subspecies. The protein is part of the bacterial plasmid replication machinery, located in a region that plays a role in the initiation of plasmid DNA replication. It has been identified in multiple subspecies of Buchnera aphidicola including those associated with Diuraphis noxia, Geoica urticularia, Rhopalosiphum padi, Thelaxes suberi, and Tetraneura caerulescens, with protein lengths ranging from 165-178 amino acids .

Methodological approach: To identify and characterize UPF0114 proteins in new bacterial species, researchers should perform comparative genomic analysis focusing on the intergenic regions between repA1 and repA2 genes, followed by sequence homology searches against established UPF0114 protein sequences.

What are the sequence characteristics of UPF0114 protein?

Methodological approach: When analyzing UPF0114 protein sequences, researchers should employ multiple sequence alignment tools to identify conserved regions across subspecies, which may indicate functionally important domains.

How should recombinant UPF0114 protein be handled in laboratory settings?

Recombinant UPF0114 protein requires specific handling procedures for optimal stability and activity:

  • Storage conditions: Store at -20°C/-80°C for extended storage

  • Working concentration: Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Stabilization: Add 5-50% glycerol (final concentration) for long-term storage

  • Usage recommendation: Keep working aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as this may compromise protein integrity

Methodological approach: Before experimental use, briefly centrifuge the vial to bring contents to the bottom, reconstitute as recommended, and prepare multiple small aliquots to prevent repeated freeze-thaw cycles.

What is the relationship between UPF0114 protein and the RepA_N family of replicons?

The UPF0114 protein is found in the intergenic region between repA1 and repA2 genes, which are part of the RepA_N family of replicons. This family is widespread among low G+C Gram-positive bacteria and plays crucial roles in plasmid replication and maintenance. The RepA protein contains a conserved domain annotated as RepA_N (pfam06970) and functions as a replication initiator protein .

The RepA_N family includes nearly 120 proteins in sequence databases, with approximately 70 associated with plasmids or phages found in low G+C Gram-positive bacteria. Sequence similarity is greatest in the N-terminal 100 amino acids where the conserved domain is located .

Methodological approach: To study the functional relationship between UPF0114 and RepA proteins, researchers should conduct protein-protein interaction studies (e.g., co-immunoprecipitation, yeast two-hybrid assays) and investigate the effects of UPF0114 mutations on RepA-mediated plasmid replication.

How do sequence variations in UPF0114 protein across different subspecies affect its function?

Sequence comparison of UPF0114 proteins from different Buchnera aphidicola subspecies reveals both conserved and variable regions. For example:

SubspeciesProtein LengthKey Sequence FeaturesUniProt ID
Diuraphis noxia167 aaMERIIEKAIYASRWLMFPVYVGLSFG...O85068
Thelaxes suberi165 aaMEKRIANIIYSSRWLMFPVYIGLAFG...O31289
Tetraneura caerulescens178 aa(Sequence not fully provided)O31285
Geoica urticularia165 aa(Sequence not fully provided)Not specified
Rhopalosiphum padi166 aa(Sequence not fully provided)Not specified

Methodological approach: To determine the functional significance of these variations, researchers should:

  • Perform site-directed mutagenesis to modify specific amino acids that differ between subspecies

  • Express these mutant proteins in appropriate host systems

  • Assess the impact on protein-protein interactions, protein-DNA interactions, and plasmid replication efficiency

  • Use structural biology techniques (X-ray crystallography, NMR) to correlate sequence differences with structural changes

What experimental systems are appropriate for studying UPF0114 protein function in vitro?

Based on the available data, researchers have successfully expressed recombinant UPF0114 protein in E. coli systems with various tags (particularly His-tags) . For functional studies, the following experimental approaches are recommended:

  • Protein expression system: E. coli has been demonstrated as an effective host for recombinant UPF0114 protein expression

  • Purification method: His-tagged proteins can be purified using immobilized metal affinity chromatography (IMAC)

  • Replication assays: In vitro plasmid replication systems, similar to those described for mini-P1 plasmid DNA, could be adapted for studying UPF0114 function

  • Protein-interaction studies: Systems that incorporate both UPF0114 and RepA proteins to study their potential interactions and functional relationships

Methodological approach: Development of an in vitro DNA-replication system consisting of purified UPF0114 protein, RepA proteins, and a mixture of appropriate bacterial replication proteins would enable detailed mechanistic studies.

How might UPF0114 protein interact with plasmid replication machinery?

While the precise function of UPF0114 protein is not explicitly described in the search results, its location in the intergenic region between repA1 and repA2 genes suggests potential involvement in plasmid replication. The RepA proteins function as replication initiator proteins , and the UPF0114 protein may interact with these or other components of the replication machinery.

In related systems, plasmid replication requires multiple initiation proteins (e.g., P1 RepA protein and E. coli DnaA protein for mini-P1 plasmid replication) . The replication process typically involves:

  • Recognition of the origin of replication by initiator proteins

  • Unwinding of DNA at the origin

  • Recruitment of replication machinery components

  • Unidirectional replication proceeding from the origin

Methodological approach: To investigate UPF0114's role in these processes, researchers should:

  • Perform DNA-binding assays to determine if UPF0114 binds specifically to regions within the plasmid origin

  • Conduct protein-protein interaction studies with known replication proteins (RepA, DnaA, DnaB, etc.)

  • Develop an in vitro replication system where components can be added or omitted to determine their specific contributions

  • Use electron microscopy to visualize replication intermediates in the presence and absence of UPF0114 protein

What are the optimal conditions for maintaining recombinant UPF0114 protein stability during experiments?

To ensure optimal stability and activity of recombinant UPF0114 protein during experiments, researchers should consider:

ParameterRecommended ConditionNotes
Storage BufferTris-based buffer with 50% glycerolOptimized for protein stability
pH8.0Based on typical buffer composition
Working Temperature4°CFor short-term use (up to one week)
Long-term Storage-20°C/-80°CUse small aliquots to avoid freeze-thaw cycles
Reconstitution SolventDeionized sterile waterTo concentration of 0.1-1.0 mg/mL
Stabilizing Agents5-50% glycerolDefault recommendation is 50%

Methodological approach: Before beginning experiments, researchers should perform stability tests under their specific experimental conditions, monitoring protein integrity using SDS-PAGE and functional assays at different time points.

How can researchers verify the integrity and activity of recombinant UPF0114 protein preparations?

To ensure recombinant UPF0114 protein preparations maintain their integrity and activity:

  • Purity assessment: Use SDS-PAGE to verify protein purity (should be >85-90%)

  • Identity confirmation: Perform western blotting with antibodies specific to the protein or tag

  • Mass spectrometry analysis: Confirm the expected molecular weight and sequence coverage

  • Functional assays: Develop specific assays based on hypothesized functions (DNA binding, protein-protein interactions)

  • Structural integrity: Use circular dichroism or fluorescence spectroscopy to assess proper folding

Methodological approach: Establish a standardized quality control workflow that incorporates multiple complementary techniques to comprehensively evaluate protein preparations before use in critical experiments.

How does UPF0114 protein compare across different bacterial plasmid systems?

The UPF0114 protein appears to be part of a larger family of proteins associated with plasmid replication, particularly in the context of the RepA_N family of replicons. Similar replicon systems have been identified in various Gram-positive bacteria, with evidence suggesting these replicons have evolved alongside their bacterial hosts .

The RepA_N family includes approximately 120 proteins in sequence databases, with about 70 associated with plasmids or phages found in low G+C Gram-positive bacteria. These plasmids are widespread among clinically important bacteria, including methicillin-resistant Staphylococcus aureus (MRSA) .

Methodological approach: When studying UPF0114 in the context of different plasmid systems, researchers should conduct comparative genomic analyses across multiple bacterial species, focusing on the organization of replication initiation regions and the presence of UPF0114-like proteins in relation to RepA homologs.

What techniques are most effective for studying potential interactions between UPF0114 protein and DNA?

To investigate potential interactions between UPF0114 protein and DNA, researchers should consider:

  • Electrophoretic mobility shift assays (EMSA): To detect protein-DNA binding

  • DNase I footprinting: To identify specific DNA sequences protected by the protein

  • Chromatin immunoprecipitation (ChIP): To study protein-DNA interactions in vivo

  • Surface plasmon resonance (SPR): To determine binding kinetics and affinity

  • Atomic force microscopy (AFM): To visualize protein-DNA complexes

  • In vitro replication assays: Similar to those developed for mini-P1 plasmid DNA replication

Methodological approach: Begin with EMSA to establish whether UPF0114 binds DNA, then proceed with more specialized techniques to characterize the nature, specificity, and functional consequences of these interactions in the context of plasmid replication.

What are the key unresolved questions about UPF0114 protein that warrant further investigation?

Several important aspects of UPF0114 protein remain to be elucidated:

  • Precise biochemical function: The specific role of UPF0114 in plasmid replication or other cellular processes

  • Structural characterization: Three-dimensional structure and its relationship to function

  • Evolutionary significance: Why this protein is conserved across multiple Buchnera aphidicola subspecies

  • Regulatory mechanisms: How UPF0114 expression and activity are regulated

  • Interaction partners: Complete mapping of proteins that interact with UPF0114

  • Potential as a therapeutic target: Given its presence in bacterial plasmids potentially involved in antibiotic resistance

Methodological approach: A comprehensive research program should employ a multidisciplinary approach combining structural biology, molecular genetics, biochemistry, and systems biology to address these knowledge gaps.

How might understanding UPF0114 protein contribute to broader research on bacterial plasmid biology?

Research on UPF0114 protein could enhance our understanding of:

  • Plasmid replication mechanisms: Particularly in the context of the RepA_N family of replicons

  • Plasmid host range determination: How specific proteins contribute to host specificity

  • Evolution of plasmid replication systems: The relationship between plasmid and host evolution

  • Antibiotic resistance dissemination: As many RepA_N family plasmids carry resistance genes

  • Development of novel antimicrobial strategies: Targeting plasmid replication as an approach to combat antimicrobial resistance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.