Recombinant UPF0114 protein YqhA (STY3326, t3074)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant UPF0114 protein YqhA, also known as YqhA protein, is a protein that belongs to the UPF0114 family . This protein, sometimes referred to as UPF0114 protein YqhA (STY3326, t3074), can be expressed in E. coli . The gene name for this protein is yqhA, and it is also known by synonyms such as Ecok1_30110 and APECO1_3421 .

Characteristics

CharacteristicDescription
SourceE. coli
TagHis (N-terminal His tag)
Protein LengthFull Length (1-164 amino acids)
FormLyophilized powder
AA SequenceMERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSLVDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATSLKNKVAASIVAISSIHLLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt; aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionBriefly centrifuge the vial prior to opening. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended .
Gene NameyqhA
SynonymsyqhA; Ecok1_30110; APECO1_3421; UPF0114 protein YqhA
UniProt IDA1AFR5
Expression Region1-164 (Full length protein)
SpeciesE. coli or Shigella flexneri

Function and Research

The YjgF/YER057c/UK114 protein family, to which YqhA belongs, is highly conserved across different life domains, but lacks a defined biochemical function . Studies suggest that members of this protein family, including YqhA, may inhibit phosphoribosylamine (PRA) synthesis .

One study found that the in vitro formation of PRA was reduced by the addition of the S. enterica YjgF protein and the human homolog, UK114, suggesting a role in regulating PRA formation .

Related Research Areas

While the primary function of YqhA is still under investigation, its potential involvement in cellular processes links it to several research areas:

  • m6A-RNA Readers: Some research on related proteins like YTHDC1, which recognizes mRNA modification, shows promise in developing inhibitors with antiproliferative activity against acute myeloid leukemia cell lines .

  • Fusion Proteins: Studies on recombinant fusion proteins such as PRO 542, used in HIV-1 treatment, provide insights into the pharmacokinetic properties and potential therapeutic applications of such proteins .

  • Antiviral Research: Analogs related to YqhA are being explored as inhibitors of SARS-CoV-2 replication, showcasing the potential of this protein family in antiviral therapies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
STY3326; t3074; UPF0114 protein YqhA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Salmonella typhi
Target Names
STY3326
Target Protein Sequence
MERFLENVMYASRWLLAPVYFGLSLALIALALKFFQEILHVLPNVFALAEADLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISAGKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDARNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
Uniprot No.

Target Background

Database Links

KEGG: stt:t3074

STRING: 220341.STY3326

Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • How does YqhA expression change under stress conditions in E. coli?

    Research indicates that YqhA expression is significantly affected by stress conditions. In a study examining sodium fluoride (NaF) exposure in E. coli under anaerobic conditions, researchers found that yqhA was among the genes whose expression was altered .

    The study demonstrated that ATP depletion caused by NaF exposure (20mM and 70mM) led to dramatic changes in transcript abundance profiles. Specifically, a subset of genes including yqhA showed differential expression patterns in response to fluoride treatment. Tiling array analysis and quantile-based K-means clustering revealed that yqhA was part of a gene cluster that showed upregulation in response to NaF treatment .

    This suggests that YqhA may play a role in bacterial stress response mechanisms, particularly under conditions that affect energy metabolism.

  • What is the relationship between YqhA and Repetitive Extragenic Palindromic (REP) sequences?

    The study examining fluoride exposure in E. coli revealed an interesting correlation between gene expression changes and the presence of Repetitive Extragenic Palindromic (REP) sequences. While not directly stating that yqhA contains REP sequences, the research showed that approximately 40% of genes highly upregulated in response to fluoride treatment contained REP sequences .

    The table below shows genes with significant expression changes and their associated REP sequences:

    Gene IDLog 2 fold change (70 mM NaF vs control)P value (t test)REP nameNo. of REPs
    proP2.620.02REP3261
    ilvX2.440.03REP2851
    exbB2.410.06REP2225
    mgtA2.410.01REP3392
    osmC1.90.01REP1221

    These findings suggest that analyzing the genomic context of yqhA, particularly any associated REP sequences, could provide insights into its regulation and function under stress conditions .

  • How conserved is YqhA across bacterial species and what does this suggest about its function?

    Analysis of protein sequence data from multiple sources indicates that YqhA is highly conserved across various enterobacterial species. The amino acid sequence is identical or nearly identical among E. coli strains (including pathogenic and non-pathogenic variants), Salmonella enterica strains, and Shigella dysenteriae .

    This high degree of conservation suggests that YqhA likely performs an important function in these bacteria. Given its upregulation during stress conditions (as shown in fluoride exposure studies), it may play a role in stress response or adaptation mechanisms that are fundamental to these bacterial species .

    The presence of YqhA in both pathogenic strains (like E. coli O157:H7, Salmonella, and Shigella) and non-pathogenic strains suggests that its function may be related to basic cellular processes rather than specific virulence mechanisms, though this requires further investigation.

Methodological Questions

  • What expression systems yield optimal results for recombinant YqhA production?

    Multiple expression systems have been successfully used for YqhA production, each with distinct advantages:

    • E. coli expression systems: Offer the best yields and shorter turnaround times, making them ideal for high-throughput studies and initial characterization work .

    • Yeast expression systems: Also provide good yields with relatively short production times. May offer some post-translational modifications compared to E. coli systems .

    • Insect cells with baculovirus: Can provide many of the post-translational modifications necessary for correct protein folding, which may be important for functional studies .

    • Mammalian cell expression systems: Potentially retain the protein's activity through appropriate post-translational modifications and folding environment. Recommended when studying protein function in contexts relevant to host-pathogen interactions .

    The choice of expression system should be guided by the specific research question. For structural studies requiring large quantities, E. coli or yeast systems are recommended. For functional studies where protein activity is critical, insect or mammalian systems may be preferable despite lower yields .

  • What purification strategies are effective for recombinant YqhA?

    Based on available product information, effective purification strategies for YqhA include:

    • Affinity chromatography: Most commercial preparations utilize tag-based purification, predominantly with N-terminal histidine tags (e.g., 10xHis-tagged) . This approach allows for efficient one-step purification using immobilized metal affinity chromatography (IMAC).

    • Optimized buffer systems: Tris-based buffers with 50% glycerol appear to be effective for maintaining protein stability after purification .

    • Purity considerations: Standard purification protocols can achieve ≥85% purity as determined by SDS-PAGE analysis .

    When designing purification protocols, researchers should consider YqhA's transmembrane nature, which may require detergent solubilization during extraction and purification steps. The specific detergent choice can significantly impact both yield and functional integrity of the purified protein.

  • How should YqhA be stored to maintain stability and activity?

    Based on manufacturer recommendations for recombinant YqhA products, optimal storage conditions include:

    • Short-term storage: Working aliquots can be stored at 4°C for up to one week .

    • Long-term storage: Store at -20°C; for extended storage periods, -80°C is recommended .

    • Stabilizing agents: The protein is typically stored in Tris-based buffer with 50% glycerol to enhance stability .

    • Handling considerations: Repeated freezing and thawing is not recommended as it can lead to protein degradation and loss of activity. Working aliquots should be prepared to minimize freeze-thaw cycles .

    • Shelf life: Liquid formulations typically have a shelf life of approximately 6 months at -20°C/-80°C, while lyophilized preparations can maintain stability for up to 12 months at the same temperatures .

  • How can researchers design experiments to investigate YqhA's function in bacterial stress response?

    Based on the fluoride exposure study and general principles of functional protein investigation, researchers could design experiments using these approaches:

    • Gene knockout/knockdown studies: Generate yqhA deletion mutants and assess phenotypic changes under various stress conditions (osmotic stress, pH stress, nutrient limitation, antibiotic exposure) .

    • Comparative transcriptomics: Perform RNA-Seq analysis comparing wild-type and yqhA mutant strains under stress conditions to identify affected pathways .

    • Protein interaction studies: Use co-immunoprecipitation or bacterial two-hybrid systems to identify protein interaction partners, which may provide clues to function.

    • Stress response assays: Given the upregulation of yqhA during sodium fluoride exposure, design experiments exposing bacteria to various stressors (oxidative stress, membrane stress, etc.) and monitor YqhA expression and localization .

    • Structural studies: While AlphaFold has generated computational models, experimental structure determination through X-ray crystallography or cryo-EM would provide valuable insights into function .

    • Comparative genomics: Analyze the genomic context of yqhA across bacterial species, particularly examining nearby genes and potential operonic structures that might suggest functional relationships.

    When designing such experiments, researchers should consider appropriate controls, replication levels, and statistical analysis methods to ensure robust and reliable results. The use of multiple complementary approaches will provide the strongest evidence for YqhA's functional role.

  • What techniques can be used to study YqhA's membrane topology and localization?

    Given YqhA's classification as a multi-pass membrane protein, several specialized techniques can be employed to study its topology and cellular localization:

    • Fusion protein approaches: Creating GFP or other fluorescent protein fusions at N- or C-termini to visualize localization within bacterial cells.

    • Protease accessibility assays: Using proteases like trypsin to cleave exposed portions of the protein, followed by mass spectrometry analysis to determine which regions were accessible.

    • Substituted cysteine accessibility method (SCAM): Introducing cysteine residues at various positions and testing their accessibility to membrane-impermeable sulfhydryl reagents.

    • Immunofluorescence microscopy: Using antibodies against YqhA or epitope tags to visualize protein distribution in fixed cells.

    • Fractionation studies: Separating membrane fractions (inner vs. outer membrane in Gram-negative bacteria) to determine YqhA's specific membrane localization.

    • Cryo-electron microscopy: For high-resolution structural analysis within the membrane environment.

    These approaches can provide complementary information about YqhA's orientation in the membrane, which may offer clues to its functional role in bacterial physiology and stress response.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.