Recombinant UPF0126 inner membrane protein yicG (yicG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point for your own preparations.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain protein integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yicG; c4470; UPF0126 inner membrane protein YicG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Target Names
yicG
Target Protein Sequence
MLLHILYLVGITAEAMTGALAAGRRRMDTFGVIIIATATAIGGGSVRDILLGHYPLGWVK HPEYVIIVATAAVLTTIVAPVMPYLRKVFLVLDALGLVVFSIIGAQVALDMGHGPIIAVV AAVTTGVFGGVLRDMFCKRIPLVFQKELYAGVSFASAVLYIALQHYVSNHDVVIISTLVF GFFARLLALRLKLGLPVFYYSHEGH
Uniprot No.

Target Background

Database Links

KEGG: ecc:c4470

STRING: 199310.c4470

Protein Families
UPF0126 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0126 inner membrane protein yicG and what organisms express it?

UPF0126 inner membrane protein yicG is a transmembrane protein belonging to the UPF0126 family. It is primarily found in various strains of Escherichia coli, including E. coli K12 (UniProt ID: P0AGM2), E. coli O6:H1 strain CFT073 (UniProt ID: P0AGM3), and related bacterial species such as Shigella flexneri (UniProt ID: P0AGM4) . This protein is encoded by the yicG gene, which is also annotated as b3646 or JW3621 in E. coli K12 .

How is yicG classified within protein families?

YicG belongs to the UPF0126 (Uncharacterized Protein Family 0126) family . Proteins in this family share structural and sequence similarities but often have poorly characterized functions. The UPF designation indicates that while the protein has been identified and sequenced, its biological function has not been fully elucidated through experimental approaches .

What expression systems are recommended for recombinant yicG production?

The most effective expression system for recombinant yicG production is an in vitro E. coli expression system . This approach is preferred because:

  • As yicG is naturally found in E. coli, the expression machinery is already optimized for this protein

  • The transmembrane nature of yicG requires appropriate membrane insertion machinery

  • E. coli-based systems can incorporate posttranslational modifications necessary for proper folding

For optimal expression, the full-length protein (amino acids 1-205) is typically used with an N-terminal tag, most commonly a His-tag (10xHis) . This facilitates subsequent purification steps while minimizing interference with protein function.

What purification strategies yield the highest purity recombinant yicG?

Purification of recombinant yicG typically involves:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA agarose for His-tagged constructs

  • Size-exclusion chromatography to separate the protein from aggregates

  • Detergent-based extraction methods to solubilize the membrane protein

These approaches can yield purity greater than 90% as determined by SDS-PAGE . The choice of detergents is critical - mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) often preserve protein structure while effectively solubilizing membrane proteins .

How should recombinant yicG be stored to maintain stability?

For optimal stability, recombinant yicG should be stored according to the following guidelines:

  • Short-term storage (up to one week): 4°C in appropriate buffer

  • Medium-term storage (months): -20°C in buffer containing 50% glycerol

  • Long-term storage (>6 months): -80°C, preferably lyophilized

Repeated freeze-thaw cycles should be strictly avoided as they significantly compromise protein integrity . For liquid formulations, the shelf life is approximately 6 months at -20°C/-80°C, while lyophilized preparations can be stable for up to 12 months at these temperatures .

The recommended storage buffer typically contains Tris-based buffer with 50% glycerol, optimized specifically for this protein's stability .

What are the recommended reconstitution protocols for lyophilized yicG?

For optimal reconstitution of lyophilized yicG:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is commonly recommended)

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Store aliquots at -20°C or -80°C for long-term storage

This procedure helps maintain protein stability and functionality while preventing degradation from multiple freeze-thaw cycles.

What experimental approaches are available for studying yicG interactions with other membrane proteins?

Several methodologies can be employed to investigate yicG interactions:

  • In vivo photocrosslinking: Incorporation of p-benzoyl-L-phenylalanine (pBPA) at specific positions allows UV-mediated crosslinking to identify interaction partners. This technique has been successfully used for similar membrane proteins like YfgM and PpiD .

  • Co-immunoprecipitation (Co-IP): Using antibodies against yicG or potential interaction partners to pull down protein complexes.

  • Membrane protein co-purification: Two-step affinity purification using differently tagged constructs to identify stable interaction partners.

  • Förster Resonance Energy Transfer (FRET): Labeling yicG and potential partners with appropriate fluorophores to detect proximity-based energy transfer.

  • Bacterial two-hybrid systems: Adapted for membrane proteins to detect protein-protein interactions in vivo.

When designing such experiments, controls for non-specific interactions are critical due to the hydrophobic nature of membrane proteins .

What biophysical methods can characterize the structural properties of yicG?

Several biophysical approaches can provide insights into yicG structure:

  • Circular Dichroism (CD) Spectroscopy: Useful for determining secondary structure content (α-helices, β-sheets)

  • Nuclear Magnetic Resonance (NMR): For detailed structural information in a membrane-mimetic environment

  • X-ray Crystallography: Challenging for membrane proteins but provides high-resolution structures when successful

  • Cryo-Electron Microscopy: Increasingly used for membrane protein structure determination

  • Molecular Dynamics Simulations: Using the known sequence to predict structure and dynamics in a lipid bilayer

  • AlphaFold2 or similar AI prediction tools: Recent advances in protein structure prediction are particularly valuable for membrane proteins like yicG that are difficult to study experimentally

What is currently known about the function of yicG in bacterial membranes?

While the specific function of yicG remains incompletely characterized, several lines of evidence provide insights:

  • As a member of the UPF0126 family, yicG is an inner membrane protein with multiple predicted transmembrane domains .

  • Recent studies on bacterial inner membrane proteins suggest potential roles in:

    • Membrane integrity maintenance

    • Transport processes

    • Protein translocation

    • Stress response pathways

  • Gene expression analyses have shown upregulation of yicG in certain conditions, particularly in transport mechanisms and membrane protein complexes .

  • The protein may be functionally related to other inner membrane proteins involved in protein translocation, similar to the YfgM-PpiD heterodimer system that interacts with the Sec translocon .

How can researchers investigate the potential role of yicG in protein translocation?

To investigate yicG's potential role in protein translocation, consider these methodological approaches:

  • Genetic knockout studies: Creating ΔyicG strains and assessing effects on protein secretion and membrane protein insertion.

  • Complementation assays: Reintroducing wild-type or mutated yicG to evaluate functional rescue.

  • Secretion reporter assays: Using fusion proteins like PhoA reporters to quantify translocation efficiency in the presence or absence of yicG.

  • Site-directed mutagenesis: Creating specific mutations in predicted functional domains to identify critical residues.

  • Interaction studies with known translocation machinery: Investigating potential interactions with SecY/E/G translocon components using techniques like in vivo photocrosslinking .

  • Suppressor screens: Identifying mutations that suppress phenotypes of yicG deletion to uncover genetic interactions.

How might yicG function relate to bacterial stress responses?

Recent research suggests potential connections between yicG and bacterial stress responses:

  • Transcriptome analysis has shown upregulation of yicG alongside other genes involved in bacterial stress responses, particularly in microalgae-bacterial communities .

  • The protein's location in the inner membrane positions it appropriately for sensing or responding to environmental stressors.

  • The genetic context of yicG, particularly its proximity to DNA damage-inducible genes in some genomic databases, suggests potential functional relationships with stress response pathways .

  • Similar to other membrane proteins like YfgM, yicG might be involved in envelope stress responses that are critical for bacterial adaptation to changing environments .

To investigate these connections, researchers could examine yicG expression under various stress conditions, analyze phenotypes of deletion mutants under stress, and investigate genetic and physical interactions with known stress response proteins.

What are the challenges in distinguishing the functional role of yicG from other UPF0126 family members?

Distinguishing yicG's function from related proteins presents several methodological challenges:

  • Functional redundancy: Multiple UPF0126 family members may have overlapping functions, requiring combinatorial knockout approaches.

  • Context-dependent function: YicG may function differently depending on growth conditions or bacterial strain backgrounds.

  • Interaction network complexity: As a membrane protein, yicG likely functions within complex protein networks that may compensate for its absence.

  • Technical limitations: Membrane proteins present inherent difficulties for many biochemical and structural approaches.

Researchers should consider:

  • Creating multiple gene knockouts to address redundancy

  • Testing phenotypes under diverse environmental conditions

  • Employing systems biology approaches to map the broader interaction network

  • Using complementary in vivo and in vitro approaches to validate findings

How can computational approaches aid in predicting yicG function?

Advanced computational methods provide valuable tools for investigating yicG:

  • Homology modeling: Using better-characterized UPF0126 family members to predict structure and function.

  • Molecular dynamics simulations: Simulating yicG behavior within a lipid bilayer to predict conformational changes and potential ligand binding sites.

  • Co-expression network analysis: Identifying genes with similar expression patterns across multiple conditions to predict functional relationships.

  • Phylogenetic profiling: Analyzing the co-occurrence of yicG with other genes across diverse bacterial species to infer functional connections.

  • Protein-protein interaction prediction: Using machine learning approaches to predict interactions with other membrane and soluble proteins.

  • AlphaFold2 and similar AI tools: Generating structural predictions that can inform functional hypotheses .

What experimental strategies can resolve contradictions in yicG functional data?

When faced with contradictory experimental results regarding yicG function, consider these methodological approaches:

  • Strain-specific effects: Test multiple bacterial strains to determine if contradictions are strain-dependent.

  • Condition-dependent function: Systematically vary environmental conditions (pH, temperature, osmolarity) to identify specific conditions where effects are consistent.

  • Technical validation: Employ complementary techniques to confirm findings (e.g., if proteomics suggests an interaction, validate with co-IP or crosslinking).

  • Quantitative analysis: Move beyond qualitative observations to quantitative measurements with appropriate statistical analysis.

  • Genetic background effects: Introduce the same yicG mutations or deletions into different genetic backgrounds to identify potential suppressor or enhancer effects.

  • Time-resolved studies: Examine effects at different time points to distinguish primary from secondary effects.

How might structural studies of yicG inform development of antimicrobial strategies?

Inner membrane proteins like yicG represent potential targets for novel antimicrobial approaches:

  • High-resolution structural determination of yicG could reveal unique binding pockets for small molecule development.

  • If yicG proves essential for bacterial membrane integrity or stress responses, compounds that interfere with its function could sensitize bacteria to existing antibiotics.

  • Species-specific structural differences between bacterial yicG homologs could be exploited for selective targeting.

  • Protein-protein interaction interfaces between yicG and other membrane components might represent targets for disruption by peptide mimetics.

  • Understanding yicG's structure-function relationship may reveal mechanisms of bacterial membrane organization that could inform broader antimicrobial strategies.

What techniques could resolve the membrane topology and dynamics of yicG?

Advanced approaches to determine yicG topology and dynamics include:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To identify solvent-accessible regions and conformational changes.

  • Single-molecule FRET: To monitor dynamic conformational changes in real-time.

  • Electron paramagnetic resonance (EPR) spectroscopy: Using site-directed spin labeling to determine distances between specific residues.

  • Mass spectrometry-based footprinting: To identify regions protected by membrane or interaction partners.

  • Cryo-electron tomography: To visualize yicG in its native membrane environment.

  • Fluorescence quenching approaches: To determine the orientation of specific domains relative to the membrane.

  • Nanodiscs or lipid cubic phase crystallization: To obtain structures in membrane-mimetic environments.

How might systems biology approaches enhance understanding of yicG's role in bacterial physiology?

Integration of yicG research into systems biology frameworks offers significant advantages:

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data to place yicG in broader cellular networks.

  • Genome-wide interaction screens: Synthetic genetic array (SGA) or CRISPRi screens to identify genetic interactions.

  • Network modeling: Building computational models that incorporate yicG into membrane protein interaction networks.

  • Population-level studies: Examining variation in yicG across bacterial populations to identify selective pressures.

  • Host-pathogen interaction studies: For pathogenic strains, determining if yicG influences host-pathogen dynamics.

  • Evolutionary analysis: Comparing yicG sequence and function across diverse bacterial species to understand its evolutionary importance.

These approaches can contextualize yicG's function within the broader bacterial physiological landscape and potentially reveal unexpected functional connections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.