Recombinant UPF0154 protein spyM18_0409 (spyM18_0409)

What is UPF0154 protein spyM18_0409 and what organism does it originate from?

UPF0154 protein spyM18_0409 (UniProt ID: P67297) is a small protein (80 amino acids) originating from Streptococcus pyogenes serotype M18, a gram-positive bacterial pathogen. The protein belongs to the UPF0154 family, which stands for Uncharacterized Protein Family 0154, indicating its function has not been fully characterized in scientific literature. The protein's amino acid sequence (MSTAIWILLLIVALGVGVFGGIFIARKQIEKEIGEHPRLTPEAIREMMSQMGQKPSEAKIQQTYRNIIKQSKAAVSKGKK) suggests a structure with hydrophobic regions, potentially indicating a membrane-associated function .

How is the recombinant version of spyM18_0409 typically produced for research applications?

The recombinant version of spyM18_0409 is typically produced using E. coli expression systems with an N-terminal histidine tag to facilitate purification. The protein is expressed as the full-length sequence (amino acids 1-80) and purified to greater than 90% purity as determined by SDS-PAGE. Following expression and purification, the protein is typically prepared as a lyophilized powder in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain protein stability during storage and reconstitution .

What structural and functional characteristics define UPF0154 family proteins?

UPF0154 family proteins, including spyM18_0409, are characterized by their small size (typically 80-100 amino acids) and conserved sequence motifs across multiple bacterial species. Analysis of the amino acid sequence of spyM18_0409 reveals a high proportion of hydrophobic residues, particularly in the N-terminal region (MSTAIWILLLIVALGVGVFGG), suggesting it may function as a membrane-associated protein. The protein also contains charged residues in its C-terminal portion, which may be involved in protein-protein interactions or other functional activities. While the precise function remains to be fully elucidated, comparative genomic analyses suggest potential roles in stress response, membrane integrity, or pathogenicity mechanisms within S. pyogenes .

What are the optimal conditions for reconstituting lyophilized spyM18_0409 protein for experimental use?

For optimal reconstitution of lyophilized spyM18_0409 protein, first centrifuge the vial briefly to bring all contents to the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and allow complete dissolution by gentle mixing rather than vigorous vortexing, which can lead to protein denaturation. For long-term storage stability, add glycerol to a final concentration of 5-50% (with 50% being optimal for extended storage). The reconstituted protein solution should be aliquoted in small volumes to prevent repeated freeze-thaw cycles, which significantly reduce protein activity. Store the aliquots at -20°C for short-term use or -80°C for long-term storage. When designing experiments, consider performing pilot studies to determine the optimal protein concentration for your specific assay conditions, as this may vary depending on the experimental setup .

How can researchers verify the structural integrity and activity of spyM18_0409 after reconstitution?

To verify the structural integrity and activity of spyM18_0409 after reconstitution, researchers should employ multiple complementary techniques. Start with SDS-PAGE analysis to confirm protein purity and molecular weight (expected band at approximately 8-9 kDa plus the His-tag contribution). Circular dichroism (CD) spectroscopy can be used to assess secondary structure integrity by comparing spectra before and after storage. For functional verification, since the specific activity of spyM18_0409 is not fully characterized, researchers might consider membrane association assays, lipid binding experiments, or bacterial complementation studies with knockout strains. Additionally, thermal shift assays can provide information about protein stability under different buffer conditions. If antibodies against spyM18_0409 are available, Western blotting can confirm the protein's identity and integrity. Document all verification steps meticulously in a standardized format to ensure experimental reproducibility .

What experimental approaches are most suitable for investigating potential binding partners of spyM18_0409?

To investigate potential binding partners of spyM18_0409, multiple complementary approaches should be employed. Pull-down assays utilizing the protein's His-tag are particularly effective for initial screening, where the recombinant protein is immobilized on Ni-NTA beads and incubated with bacterial lysates from S. pyogenes or host cells. Co-immunoprecipitation experiments with antibodies against the His-tag or the protein itself can verify interactions in more native conditions. For higher-throughput analysis, consider a bacterial two-hybrid system or yeast two-hybrid screens modified for bacterial proteins. Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) should be used to quantify binding affinities for identified interactions. Crosslinking mass spectrometry can provide structural insights into the interaction interfaces. For membrane-associated functions suggested by the protein's sequence, consider membrane-specific techniques such as liposome binding assays or fluorescence resonance energy transfer (FRET) studies with labeled protein and potential membrane components. Document all interactions in a systematic database with corresponding experimental conditions and statistical analyses to facilitate comprehensive interaction mapping .

How should researchers design a proper data table for experiments involving spyM18_0409 protein?

When designing data tables for experiments involving spyM18_0409 protein, researchers should follow systematic scientific data presentation principles. The table should include a clear, descriptive title indicating the relationship between variables being studied (e.g., "Effects of Temperature on spyM18_0409 Binding Affinity to Membrane Fractions"). Structure the table with the independent variable (what you deliberately change) in the leftmost column and dependent variables (what you measure) in subsequent columns. For reproducibility, include multiple trial columns followed by a derived quantity column (typically averages) with appropriate statistical measures such as standard deviation or standard error .

Include methodological notes below the table detailing experimental conditions, protein concentration, buffer composition, and analysis methods. Ensure all measurements include appropriate units and that significant figures are consistent throughout. For complex datasets involving multiple variables, consider hierarchical organization or splitting into related tables. Remember that thorough documentation of experimental parameters is essential for reproducibility in protein interaction studies .

What statistical approaches are most appropriate for analyzing spyM18_0409 protein interaction data?

For analyzing spyM18_0409 protein interaction data, multiple statistical approaches should be considered depending on the experimental design and data characteristics. For binding kinetics experiments, nonlinear regression analysis using models like one-site or two-site binding is appropriate to determine dissociation constants (Kd). When comparing binding across multiple conditions, use analysis of variance (ANOVA) followed by post-hoc tests (such as Tukey's HSD) to identify significant differences while controlling for multiple comparisons. For co-localization studies, calculate Pearson's or Mander's correlation coefficients to quantify spatial relationships. In pull-down or co-immunoprecipitation experiments, implement fold-enrichment calculations normalized to appropriate controls, with statistical significance established through t-tests or non-parametric alternatives (Mann-Whitney U) for non-normally distributed data. For more complex datasets integrating multiple interaction parameters, consider principal component analysis (PCA) or hierarchical clustering to identify patterns. Regardless of the approach, always report effect sizes alongside p-values, and implement appropriate corrections for multiple hypothesis testing (such as Benjamini-Hochberg procedure) to control false discovery rates. Document all statistical methods, software packages, and versions in your methods section to ensure reproducibility .

How can researchers troubleshoot low protein solubility or precipitation issues with recombinant spyM18_0409?

When encountering solubility or precipitation issues with recombinant spyM18_0409, implement a systematic troubleshooting approach. First, optimize the reconstitution buffer by testing a pH range (7.0-9.0) since the protein's theoretical isoelectric point affects solubility. Consider adding solubility enhancers such as non-ionic detergents (0.01-0.1% Triton X-100 or NP-40) which may stabilize hydrophobic regions suggested by the amino acid sequence MSTAIWILLLIVALGVGVFGGIFIAR. Adjust ionic strength by testing NaCl concentrations between 50-500 mM to find optimal electrostatic shielding conditions. For severe aggregation issues, addition of arginine (50-100 mM) or low concentrations of urea (0.5-1 M) may help without denaturing the protein. Reconstitution temperature is critical—try slow reconstitution at 4°C rather than room temperature. If precipitation occurs during storage, implement a centrifugation step (14,000 × g for 10 minutes) before experiments to remove aggregates. Document each modification systematically in a troubleshooting table recording protein concentration, buffer composition, additives, and visible precipitation or turbidity measurements. Consider dynamic light scattering to quantitatively assess aggregation states under different conditions. For persistent issues, explore alternative expression constructs with solubility-enhancing fusion partners like MBP or SUMO .

What methodological approaches would best elucidate the membrane association properties of spyM18_0409 suggested by its amino acid sequence?

To elucidate the membrane association properties of spyM18_0409, implement a multi-technique approach targeting the hydrophobic N-terminal region (MSTAIWILLLIVALGVGVFGG). Begin with computational predictions using algorithms like TMHMM, Phobius, and TOPCONS to generate testable hypotheses about transmembrane domains or membrane anchoring regions. For experimental validation, perform liposome binding assays using fluorescently-labeled protein with lipid compositions mimicking bacterial membranes, quantifying association through fluorescence resonance energy transfer (FRET) or flotation assays. Circular dichroism spectroscopy in the presence and absence of membrane mimetics (detergent micelles or nanodiscs) can reveal structural changes upon membrane interaction. For more detailed structural insights, employ hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify membrane-protected regions. In cellular contexts, fluorescence microscopy with GFP-tagged proteins in bacterial expression systems can visualize localization patterns, while fractionation experiments can biochemically separate membrane-associated from cytoplasmic protein. For highest resolution studies, consider solid-state NMR spectroscopy of isotopically-labeled protein reconstituted into lipid bilayers to determine precise membrane topology and insertion depth. Document findings in standardized formats that correlate sequence features with experimental membrane interaction data, facilitating construction of a comprehensive membrane association model .

How can researchers design experiments to investigate the potential role of spyM18_0409 in Streptococcus pyogenes pathogenicity or stress response?

To investigate spyM18_0409's role in S. pyogenes pathogenicity or stress response, implement a comprehensive experimental approach combining genetic, biochemical, and infection models. Start by generating clean deletion mutants (ΔspyM18_0409) and complemented strains using allelic exchange methodologies, confirming changes by whole-genome sequencing to rule out off-target effects. Perform phenotypic characterization under various stress conditions (oxidative, acid, osmotic, antimicrobial peptides) using growth curves, survival assays, and microscopic analysis to identify specific sensitivities. For pathogenicity assessment, compare wild-type and mutant strains in established infection models, including human cell culture systems (epithelial, neutrophil, macrophage interactions) and appropriate animal models analyzing bacterial burden, dissemination, and host response markers. Employ RNA-seq and proteomics to identify differentially expressed genes/proteins in the mutant, constructing regulatory networks through bioinformatic analysis. For mechanistic insights, perform protein localization studies using immunogold electron microscopy or super-resolution fluorescence microscopy during infection processes. Consider host protein interaction studies using crosslinking coupled with mass spectrometry to identify potential targets during infection. Document all findings in standardized formats with appropriate controls and statistical analyses, linking molecular mechanisms to observed phenotypes through multiple lines of evidence .

How does spyM18_0409 compare structurally and functionally to homologous proteins in other bacterial species?

Comparative analysis of spyM18_0409 with homologous UPF0154 family proteins across bacterial species reveals both conserved features and species-specific adaptations. Sequence alignment of UPF0154 proteins from various streptococcal species (S. pyogenes, S. pneumoniae, S. agalactiae) and more distant relatives (Staphylococcus aureus, Enterococcus faecalis) shows highest conservation in the hydrophobic N-terminal region, suggesting evolutionary preservation of membrane association properties. The central region containing the sequence KQIEKEIGEHPRLTPEAIREMMS shows moderate conservation, potentially indicating a functional domain involved in protein-protein interactions or enzymatic activity. The C-terminal region displays greater sequence divergence, possibly reflecting species-specific adaptations to different ecological niches or host interaction strategies. Phylogenetic analysis places spyM18_0409 within a clade of proteins from pyogenic streptococci, suggesting functional specialization related to this group's pathogenic lifestyle. Secondary structure predictions across homologs consistently identify an N-terminal α-helical region and a mixed α/β structure in the central domain, despite sequence variations. In species where functional data exists for homologs, roles in stress response, cell envelope integrity, and virulence regulation have been documented, providing testable hypotheses for spyM18_0409 function. The comparative approach reveals that while the core structural elements appear conserved across bacterial taxa, the specific functional adaptations may vary significantly, highlighting the importance of experimental validation in S. pyogenes specifically .

What bioinformatic approaches can predict potential functional domains or interaction motifs in spyM18_0409?

To predict functional domains and interaction motifs in spyM18_0409, implement a comprehensive bioinformatic pipeline combining sequence-based, structure-based, and evolutionary approaches. Begin with sequence-based tools including InterPro, Pfam, and SMART to identify known domains, though results may be limited for uncharacterized protein families. For potential protein-protein interaction motifs, employ specialized predictors like ELM (Eukaryotic Linear Motif) adapted for bacterial contexts, and ANCHOR for disordered binding regions. The sequence PRLTPEAIREM in the central region should be scrutinized as it contains proline and charged residues often associated with interaction interfaces. For structural insights, implement homology modeling using AlphaFold2 or RoseTTAFold, followed by structure-based function prediction through ProFunc or COFACTOR to identify potential binding pockets or catalytic sites. Analyze surface electrostatic potential to identify charged patches that might indicate interaction regions, particularly in the C-terminal sequence KPSEAKIQQTYRNIIKQSKAAVSKGKK with its concentration of lysine residues. Apply evolutionary approaches like conservation surface mapping to identify functionally constrained residues, and coevolution analysis (GREMLIN, EVcouplings) to predict residue pairs likely to interact. For genomic context insights, examine the spyM18_0409 gene neighborhood across multiple Streptococcus genomes to identify consistently co-occurring genes that may indicate functional relationships. Document all predictions with confidence scores and supporting evidence in a comprehensive format that enables subsequent experimental validation strategies .

What are the most promising future research directions for understanding spyM18_0409's role in bacterial physiology and pathogenesis?

The most promising future research directions for understanding spyM18_0409's role center on integrated approaches linking molecular function to bacterial physiology and pathogenesis. Priority should be given to developing conditional knockout systems in S. pyogenes to study gene essentiality under various conditions, combined with high-resolution transcriptomic and proteomic profiling to identify regulatory networks and stress-responsive pathways involving this protein. The hydrophobic N-terminal region (MSTAIWILLLIVALGVGVFGG) strongly suggests membrane association, warranting detailed membrane topology studies using cysteine accessibility methods and fluorescence resonance energy transfer (FRET) approaches to precisely determine membrane orientation and potential dynamic changes during stress response. Given the protein's small size and potential involvement in protein-protein interactions, interactome studies using BioID or APEX2 proximity labeling would be valuable to identify the protein's neighborhood within the bacterial cell under different conditions. Host-pathogen interaction studies focusing specifically on spyM18_0409's potential role during infection should employ tissue-specific models and immunological readouts. For translational potential, high-throughput screening for small molecule inhibitors targeting this protein could be pursued if evidence supports its essentiality. Cross-species complementation studies with homologs from other streptococci would provide evolutionary insights into functional conservation and specialization. All research should employ rigorous controls, statistical validation, and data sharing in standardized formats to accelerate collaborative progress in understanding this uncharacterized protein family .

How can researchers design a comprehensive experimental workflow to systematically characterize the structural and functional properties of spyM18_0409?

A comprehensive experimental workflow for systematically characterizing spyM18_0409 should follow a multi-tiered approach moving from basic characterization to complex functional analyses. Begin with protein production optimization, testing multiple constructs (full-length and domain-based) with various tags (His, GST, MBP) to maximize solubility and yield, followed by thorough biophysical characterization including size exclusion chromatography, dynamic light scattering, and circular dichroism to establish baseline structural properties. For structural determination, pursue parallel approaches including X-ray crystallography, NMR (suitable for this 80-amino acid protein), and complementary techniques like hydrogen-deuterium exchange mass spectrometry to map flexible regions. For functional characterization, implement a three-phase approach: (1) subcellular localization studies using fractionation and immunofluorescence microscopy with custom antibodies; (2) interaction partner identification through pull-downs, crosslinking mass spectrometry, and bacterial two-hybrid screening; and (3) phenotypic analysis using clean deletion mutants and complemented strains under various stress conditions and infection models. In parallel, perform evolutionary analyses across Streptococcus species to identify conserved features suggesting functional importance. Integrate all data streams using computational approaches including molecular dynamics simulations to generate testable mechanistic hypotheses. Document the entire workflow in a standardized electronic laboratory notebook format with comprehensive metadata and quality control metrics to ensure reproducibility. This systematic approach allows for iteration and refinement at each stage based on emerging data, ultimately building a coherent model of spyM18_0409 function within bacterial physiology .