Recombinant UPF0187 protein yneE (yneE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yneE; Z2185; ECs2127; UPF0187 protein YneE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
yneE
Target Protein Sequence
MIVRPQQHWLRRIFVWHGSVLSKISSRLLLNFLFSIAVIFMLPWYTHLGIKFTLAPFSIL GVAIAIFLGFRNNAGYARYVEARKLWGQLMIASRSLLREVKTTLPDSASVREFARLQIAF AHCLRMTLRKQPQVEVLAHYLKTEDLQRVLASNSPANRILLIMGEWLAVQRRNGQLSDIL FISLNDRLNDISAVLAGCERIAYTPIPFAYTLILHRTVYLFCIMLPFALVVDLHYMTPFI SVLISYTFISLDCLAEELEDPFGTENNDLPLDAICNAIEIDLLQMNDEAEIPAKVLPDRH YQLT
Uniprot No.

Target Background

Database Links

KEGG: ece:Z2185

STRING: 155864.Z2185

Protein Families
UPF0187 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0187 protein yneE?

YneE is a member of the UPF0187 protein family, where "UPF" stands for Uncharacterized Protein Family, indicating that at the time of classification, its function was not fully understood. YneE is a 304-amino acid protein found in various bacterial species and has been identified as a conserved sporulation protein that inhibits DNA replication in Bacillus subtilis . The protein contains several transmembrane domains and has a molecular function linked to cell cycle control. When studying yneE, researchers should note that its cellular localization and topological arrangement are critical for understanding its functional mechanisms.

What bacterial species express yneE protein?

YneE is predominantly found in gram-positive bacteria, particularly in Bacillus subtilis where its function in sporulation has been well-documented . The protein is also expressed in Escherichia coli, where the recombinant form (Q8XAZ3) can be produced for research purposes . When designing experiments involving yneE, it's important to consider species-specific variations in protein sequence, expression patterns, and functional roles. The protein's conservation across different bacterial species suggests an evolutionarily important role in bacterial physiology.

How does yneE inhibit DNA replication in Bacillus subtilis?

YneE has been shown to inhibit DNA replication in Bacillus subtilis, a finding first reported by Rahn-Lee et al. in 2009 . The mechanism appears to involve direct or indirect interaction with the DNA replication machinery. Current models suggest that yneE may:

  • Interact with replication initiation proteins

  • Alter chromosome accessibility through membrane associations

  • Modulate regulatory pathways affecting replication timing

When designing experiments to further investigate this mechanism, researchers should focus on protein-protein interaction studies, DNA binding assays, and genetic approaches that can distinguish between direct and indirect effects on replication machinery.

What techniques are most effective for studying yneE-DNA interactions?

When investigating potential yneE-DNA interactions, researchers should employ multiple complementary approaches:

TechniqueApplicationAdvantagesLimitations
Electrophoretic Mobility Shift Assay (EMSA)Detection of protein-DNA bindingSimple, quantifiableLimited information about binding sites
Chromatin Immunoprecipitation (ChIP)Identification of in vivo DNA binding sitesMaps genome-wide interactionsRequires specific antibodies
DNase FootprintingPrecise mapping of binding sitesBase-pair resolutionLabor intensive
Surface Plasmon Resonance (SPR)Binding kineticsReal-time measurementsRequires purified components

When designing these experiments, it's essential to include appropriate controls, such as known DNA-binding proteins and non-relevant DNA sequences, to validate specificity.

How can I design randomized controlled experiments to study yneE function in vivo?

When designing in vivo experiments to study yneE function, proper randomization, replication, and comparison are essential principles to follow3. A well-designed experiment should:

  • Clearly define independent variables (e.g., yneE expression levels) and dependent variables (e.g., DNA replication rates)

  • Identify and control for confounding factors

  • Include appropriate randomization to prevent selection bias

  • Ensure adequate replication for statistical power

  • Include proper controls (positive, negative, and vehicle)

As noted by Montgomery, "All experiments are designed experiments; some of them are designed well and some of them are designed really badly. The badly designed ones often tell you nothing."3 When studying yneE, particularly its effects on sporulation or DNA replication, consider using genetic approaches such as:

ApproachAdvantagesConsiderations
Gene knockoutComplete elimination of functionMay be lethal; compensatory mechanisms
Conditional expressionTemporal control of expressionLeaky expression; non-physiological levels
Point mutationsSpecific functional domainsMay have subtle phenotypes
Fluorescent taggingLocalization studiesTags may affect function

What purification strategies are most effective for recombinant yneE?

For optimal purification of His-tagged recombinant yneE, a multi-step approach is recommended:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Intermediate purification: Ion exchange chromatography

  • Polishing: Size exclusion chromatography

Buffer optimization is critical, as the protein contains multiple hydrophobic regions. Consider adding stabilizing agents such as glycerol (5-10%) to maintain solubility. For storage, lyophilization in Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been shown to preserve activity . Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol addition for long-term storage at -20°C/-80°C .

How can I resolve issues with yneE protein solubility and stability?

YneE protein solubility challenges are common due to its multiple hydrophobic regions. When encountering solubility issues:

  • Modify expression conditions:

    • Reduce expression temperature to 16-18°C

    • Decrease inducer concentration

    • Use specialized E. coli strains (e.g., C41/C43)

  • Buffer optimization strategies:

    • Include mild detergents (0.05-0.1% Triton X-100)

    • Add stabilizing agents (5-10% glycerol)

    • Adjust ionic strength (150-300 mM NaCl)

    • Test different pH ranges (pH 7.0-8.5)

  • Storage considerations:

    • Avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for up to one week

    • Consider flash-freezing in liquid nitrogen before -80°C storage

How do I interpret contradictory results in yneE functional studies?

When faced with contradictory results in yneE studies, a systematic approach to data interpretation is essential:

  • Evaluate experimental differences:

    • Expression systems and tags

    • Purification methods

    • Assay conditions

    • Bacterial strains and genetic backgrounds

  • Consider protein state and quality:

    • Confirm protein integrity via SDS-PAGE and mass spectrometry

    • Assess proper folding through activity assays

    • Verify oligomeric state through size exclusion chromatography

  • Analyze context-dependent functions:

    • YneE may have different roles depending on growth phase

    • Consider interactions with other cellular components

    • Evaluate relevance of in vitro versus in vivo conditions

What are promising areas for future yneE research?

Future research on yneE protein should focus on:

  • Structural biology approaches to determine three-dimensional structure

  • Systems biology analysis of yneE interactome during different growth phases

  • Comparative genomics to understand evolutionary conservation and divergence

  • Development of small molecule modulators of yneE function

  • Investigation of yneE as a potential antimicrobial target

When designing experiments in these areas, researchers should employ complementary approaches and consider collaboration with specialists in respective fields. The link between yneE's role in DNA replication inhibition and sporulation represents a particularly promising research direction .

How can high-throughput approaches advance our understanding of yneE?

High-throughput approaches offer significant potential for accelerating yneE research:

ApproachApplication to yneE ResearchMethodological Considerations
RNA-SeqTranscriptional responses to yneE modulationRequires careful experimental design and time-course analysis
ProteomicsIdentification of yneE interaction partnersSample preparation critical for membrane proteins
MetabolomicsMetabolic consequences of yneE activityQuenching methods crucial for accurate results
CRISPR screensGenetic interactors of yneELibrary design should focus on relevant pathways

When implementing these approaches, researchers should incorporate appropriate controls and validation experiments to confirm high-throughput findings through targeted conventional methods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.