Recombinant UPF0208 membrane protein VP2081 (VP2081)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
VP2081; UPF0208 membrane protein VP2081
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-150
Protein Length
full length protein
Species
Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Target Names
VP2081
Target Protein Sequence
MSNKVGLIHSLKDGQSYMEIWPVRKELGAIFPEQRIIKATRFGIKVMPAVAAISVLTQMA FNNYNALPQSIVVALFAISLPLQGIWWLGARSNTKLPPSLASWYRELHQKIVETGFALEP VKARPRYKELAIILNRAFRQLDKSSLERWF
Uniprot No.

Target Background

Database Links

KEGG: vpa:VP2081

STRING: 223926.VP2081

Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0208 membrane protein VP2081?

VP2081 is classified as a UPF0208 family membrane protein originating from Vibrio parahaemolyticus Serotype O3:K6. It is currently designated as a hypothetical protein, suggesting its precise biological function remains to be fully characterized . The protein consists of 150 amino acids and has properties consistent with integral membrane proteins. As a member of the UPF (Uncharacterized Protein Family) classification, VP2081 represents one of many membrane proteins awaiting detailed functional annotation through experimental validation.

What expression systems are optimal for recombinant VP2081 production?

Multiple expression systems have been successfully employed for VP2081 production, each with distinct advantages depending on research objectives. These include:

Expression SystemAdvantagesTypical YieldRecommended Application
Cell-Free ExpressionRapid production, avoids toxicity issues, suitable for difficult-to-express proteinsModerateInitial characterization, small-scale studies
E. coliCost-effective, scalable, well-established protocolsHighStructural studies, biochemical assays
YeastPost-translational modifications, eukaryotic environmentModerate-HighFunctional studies
BaculovirusComplex post-translational modifications, high yieldHighInteraction studies
Mammalian CellNative-like post-translational modificationsLow-ModerateFunctional studies requiring mammalian processing

E. coli systems specifically have been documented to achieve greater than 90% purity for His-tagged VP2081, making it particularly suitable for structural and biochemical investigations .

What are the critical considerations for membrane protein expression in E. coli?

When expressing VP2081 in E. coli, researchers should address several key challenges inherent to membrane protein production:

  • Toxicity management: Membrane protein overexpression can disrupt host cell membrane integrity, necessitating tightly controlled induction protocols.

  • Expression rate modulation: Lower temperatures (16-25°C) and reduced inducer concentrations often improve proper folding.

  • Host strain selection: C41(DE3) and C43(DE3) strains are engineered specifically for membrane protein expression and may improve VP2081 yields.

  • Fusion partners: Addition of solubility-enhancing tags (MBP, SUMO) can improve expression while His-tags facilitate purification .

Implementing these strategies can significantly improve functional VP2081 yields and reduce formation of inclusion bodies, which is a common challenge in membrane protein expression systems.

What purification strategies yield the highest purity of recombinant VP2081?

Achieving high-purity VP2081 preparations typically involves multi-step purification protocols:

  • Initial extraction: Selective membrane solubilization using detergents like DDM, LMNG, or digitonin that maintain protein stability and native conformation.

  • Affinity chromatography: Utilizing the N-terminal His-tag for IMAC purification, which can achieve >85% purity in a single step .

  • Size exclusion chromatography (SEC): Further purification to >90% purity and assessment of protein homogeneity and oligomeric state.

  • Optional ion exchange chromatography: For removal of specific contaminants if required for downstream applications.

The reported purity of commercially available recombinant VP2081 ranges from ≥85% to >90% as determined by SDS-PAGE analysis, indicating the effectiveness of these purification approaches .

How can researchers verify the structural integrity of purified VP2081?

Multiple complementary techniques are recommended for comprehensive assessment of VP2081 structural integrity:

These methodologies collectively provide a comprehensive profile of VP2081 structural properties post-purification, ensuring samples are suitable for downstream applications.

What are optimal storage conditions for maintaining VP2081 stability?

Based on documented protocols for VP2081 and similar membrane proteins, the following storage recommendations apply:

  • Short-term storage (up to one week): 4°C in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 .

  • Long-term storage: -20°C/-80°C in aliquots containing 50% glycerol to prevent freeze-thaw damage.

  • Lyophilization: VP2081 can be stored as lyophilized powder and reconstituted in deionized sterile water to 0.1-1.0 mg/mL.

Critical caution: Repeated freeze-thaw cycles should be strictly avoided as they significantly compromise protein integrity . Working aliquots should be prepared during initial thawing to minimize subsequent freeze-thaw events.

What reconstitution methods are most effective for lyophilized VP2081?

Optimal reconstitution of lyophilized VP2081 follows this methodological approach:

  • Brief centrifugation of the vial prior to opening to ensure all material is at the bottom.

  • Addition of deionized sterile water to achieve 0.1-1.0 mg/mL protein concentration.

  • Gentle mixing without vortexing to avoid protein denaturation.

  • Addition of glycerol to a final concentration of 50% for samples intended for long-term storage.

  • Aliquoting into single-use volumes to prevent repeated freeze-thaw cycles .

This protocol maximizes recovery of functional protein while minimizing aggregation or denaturation during the reconstitution process.

How can researchers study VP2081's membrane integration and topology?

Multiple experimental approaches can elucidate VP2081's membrane orientation and topological arrangement:

  • Protease accessibility assays: Selective digestion of exposed protein regions followed by mass spectrometry to identify protected domains.

  • Fluorescence-based approaches: Site-specific labeling with environment-sensitive probes to determine membrane-embedded regions.

  • Native-nanoBleach microscopy: A recently developed technique that preserves the native membrane environment while achieving high-resolution visualization of membrane protein organization .

  • Cryo-electron microscopy: For structural determination of VP2081 in nanodiscs or detergent micelles, providing insight into transmembrane domain arrangement.

These methods collectively provide complementary data on VP2081's membrane integration, crucial for understanding its structural organization and potential functional mechanisms.

What experimental approaches can identify potential VP2081 interaction partners?

Characterizing VP2081's protein-protein interactions requires specialized membrane protein-compatible methodologies:

  • Membrane Proteome Array (MPA): Cell-based screening system containing ~6,000 human membrane proteins that can identify cross-reactive interactions or homologous binding partners .

  • Co-immunoprecipitation with crosslinking: To capture transient interactions within the membrane environment.

  • Bacterial two-hybrid systems: Modified specifically for membrane protein interaction studies.

  • Proximity labeling (BioID/APEX): For identifying neighboring proteins in the native cellular context.

These approaches account for the unique challenges of studying membrane protein interactions while preserving their native environment and conformation as much as possible.

What biophysical techniques are most suitable for VP2081 functional studies?

Given VP2081's uncharacterized functional nature, comprehensive biophysical characterization is essential:

  • Electrophysiology: If VP2081 functions as a channel or transporter, patch-clamp techniques can elucidate its conductive properties.

  • Isothermal titration calorimetry (ITC): For quantifying binding interactions with potential ligands or substrates.

  • Surface plasmon resonance (SPR): Determination of binding kinetics and affinities with interacting molecules.

  • Microscale thermophoresis (MST): Particularly useful for membrane proteins as it requires minimal sample and can be performed in detergent solutions.

These complementary techniques provide multiple lines of evidence for functional characterization, essential for annotating this hypothetical protein.

How can researchers reconstitute VP2081 into artificial membrane systems?

For functional studies requiring a lipid bilayer environment, several reconstitution approaches are applicable:

  • Proteoliposome formation: Controlled incorporation of purified VP2081 into liposomes composed of defined lipid mixtures.

  • Nanodiscs: Incorporation into disc-shaped lipid bilayers stabilized by membrane scaffold proteins, offering a native-like environment with defined size.

  • Polymer-based systems (SMALP): Extraction and maintenance of VP2081 in native lipid environments using styrene-maleic acid copolymers.

  • Lipid cubic phase: Particularly useful for structural studies or if VP2081 requires specific lipid interactions for function.

Each system offers distinct advantages depending on the intended experimental application, from structural studies to functional characterization .

What mass spectrometry approaches are most effective for VP2081 characterization?

Mass spectrometry offers powerful tools for VP2081 characterization:

  • Intact protein MS: Verification of molecular weight and assessment of post-translational modifications.

  • Hydrogen-deuterium exchange MS (HDX-MS): Mapping of solvent-accessible regions and conformational dynamics.

  • Crosslinking MS (XL-MS): Identification of intramolecular contacts to validate structural models.

  • Native MS: Analysis of membrane protein-lipid interactions through specialized ionization techniques that maintain non-covalent interactions .

These methods provide molecular-level insights into VP2081 structure and dynamics that complement other biophysical characterization techniques.

What computational approaches can predict VP2081 function?

In silico methods can generate testable hypotheses about VP2081 function:

  • Homology modeling: Generation of structural models based on related proteins with known structures.

  • Molecular dynamics simulations: Investigation of VP2081 behavior within a lipid bilayer environment.

  • Binding site prediction: Identification of potential small molecule or protein interaction interfaces.

  • Evolutionary analysis: Identification of conserved residues across UPF0208 family members that may indicate functional importance.

These computational predictions should be systematically validated through experimental approaches, creating a robust research pipeline for functional annotation.

How can researchers overcome protein aggregation during VP2081 purification?

Membrane protein aggregation represents a significant challenge that can be addressed through:

  • Detergent optimization: Systematic screening of detergent types and concentrations to identify those that maintain monodispersity.

  • Buffer optimization: Adjustment of ionic strength, pH, and addition of stabilizing agents like glycerol or specific lipids.

  • Thermal stability screening: Identification of conditions that maximize protein stability using methods like FSEC-TS.

  • Addition of specific lipids: Including physiologically relevant lipids that may stabilize VP2081 structure.

Implementation of these strategies has been demonstrated to reduce aggregation in challenging membrane proteins, including hypothetical proteins like VP2081 .

What strategies can improve low expression yields of VP2081?

When encountering poor expression of VP2081, researchers can implement:

  • Codon optimization: Adaptation of the VP2081 gene sequence to the expression host's codon bias.

  • Fusion partners: Addition of solubility-enhancing tags that can be later removed through precision proteases.

  • Periplasmic targeting: Directing expression to the E. coli periplasm to potentially improve folding.

  • Expression strain engineering: Selection of specialized strains or modification of chaperone levels to improve membrane protein folding.

These approaches have proven effective for improving yields of challenging membrane proteins in heterologous expression systems, potentially increasing VP2081 production several-fold .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.