Recombinant UPF0208 membrane protein VV1_2222 (VV1_2222)

What is UPF0208 membrane protein VV1_2222 and what organism does it originate from?

UPF0208 membrane protein VV1_2222 is a transmembrane protein isolated from Vibrio vulnificus, a gram-negative bacterium. The protein consists of 150 amino acids and is classified as part of the UPF0208 protein family, which contains proteins of unknown function. The full amino acid sequence is: MNNKVGLAHSLRDGQKYMDTWPMRKELSAIFPEQRIIKATRFGIKVMPAIAAISVLTQMAFNNYQALPQAIVMALFALSLPLQGMWWLGHRSNTQLPPALATWYRELHQKIVESGSALEPLKSRPRYKELAHTLNRAFRHLDKSALERWF . As a membrane protein, it is likely involved in cellular transport or signaling processes, though specific functions remain to be fully characterized through experimental studies.

What are the structural characteristics of UPF0208 membrane protein VV1_2222?

The UPF0208 membrane protein VV1_2222 exhibits several structural features typical of transmembrane proteins. Based on sequence analysis, the protein contains hydrophobic regions consistent with membrane-spanning domains, particularly in the region containing "AIVMALFALSLPLQGMWWLGH", which shows characteristic patterns of membrane-embedded segments . The protein is identified by UniProt ID Q8DAH7 and the gene is annotated as VV1_2222 in the Vibrio vulnificus genome . When expressed as a recombinant protein, it typically displays molecular weight characteristics consistent with its 150 amino acid length, plus any additional weight from fusion tags utilized in the expression system.

What expression systems are commonly used for recombinant production of VV1_2222?

Multiple expression systems have been utilized for the recombinant production of UPF0208 membrane protein VV1_2222, with each offering distinct advantages:

E. coli expression systems are most commonly employed, particularly for structural studies, as they offer the best yields and shorter turnaround times . For studies requiring proper folding or post-translational modifications, insect or mammalian cell expression systems may be preferable despite their higher complexity and cost .

What are the optimal conditions for expressing recombinant VV1_2222 in E. coli?

• Use lower induction temperatures (16-25°C instead of 37°C)

• Employ lower concentrations of inducer (IPTG)

• Consider specialized E. coli strains designed for membrane protein expression

• Include stabilizing additives like glycerol (5-10%) in growth media

• Optimize growth phase timing for induction (typically mid-log phase)

Expression is frequently performed with an N-terminal His-tag to facilitate purification, though this tag configuration should be validated for each specific research application . For membrane proteins like VV1_2222, expression levels must be carefully balanced to avoid overwhelming the membrane insertion machinery of the host cell.

What purification strategies are most effective for obtaining high-purity VV1_2222 protein?

Purification of recombinant UPF0208 membrane protein VV1_2222 requires specialized techniques due to its membrane-associated nature. The most effective purification strategy typically involves:

• Initial Extraction: Cell membrane solubilization using appropriate detergents (e.g., DDM, LDAO, or OG)

• Affinity Purification: His-tag based purification using Ni-NTA or TALON resin

• Secondary Purification: Size exclusion chromatography to remove aggregates and ensure monodispersity

• Quality Control: SDS-PAGE analysis to confirm purity (typically >90% as observed with recombinant preparations)

The purification buffer should be optimized to maintain protein stability, often including:

• 20-50 mM Tris buffer (pH 7.5-8.0)

• 100-300 mM NaCl

• 5-10% glycerol

• Critical micelle concentration (CMC) of the selected detergent

• Protease inhibitors during initial extraction steps

For structural studies, an additional ion exchange chromatography step may be beneficial to achieve the highest purity. The final product is typically stored in a Tris-based buffer with 50% glycerol to maintain stability during storage .

How should researchers troubleshoot low expression yields of VV1_2222?

When encountering low expression yields of recombinant UPF0208 membrane protein VV1_2222, researchers should systematically evaluate and adjust several parameters:

• Host Strain Selection: Standard BL21(DE3) strains often experience significant cell death upon membrane protein expression. Consider specialized strains like C41(DE3) or C43(DE3) that are adapted for membrane protein expression .

• Expression Conditions Matrix Testing:

  • Induction temperature (37°C, 30°C, 25°C, 18°C)

  • Inducer concentration (0.01-1.0 mM IPTG)

  • Induction duration (2h, 4h, overnight)

  • Media composition (LB, TB, 2xYT)

• Codon Optimization: If expression remains problematic, analyze the codon usage of VV1_2222 against the expression host and consider a codon-optimized synthetic gene.

• Fusion Partner Strategy: Test expression with various fusion partners known to enhance membrane protein solubility:

  • MBP (maltose-binding protein)

  • SUMO

  • Thioredoxin

• Alternative Expression Systems: If E. coli consistently yields poor results, consider alternative systems like yeast, insect cells, or cell-free expression systems, each offering different advantages for membrane protein expression .

Careful documentation of optimization experiments is crucial for systematically improving expression yields of this challenging membrane protein.

What are the optimal storage conditions for purified VV1_2222 protein?

The optimal storage conditions for purified UPF0208 membrane protein VV1_2222 are critical for maintaining structural integrity and functional activity. Based on established protocols, the following storage parameters are recommended:

• Primary Storage: Store at -20°C or -80°C for extended periods

• Storage Buffer Composition:

  • Tris-based buffer (typically pH 7.5-8.0)

  • 50% glycerol as a cryoprotectant

  • Buffer optimized specifically for this protein

• Aliquoting Strategy: Divide purified protein into single-use aliquots to avoid repeated freeze-thaw cycles, which can significantly compromise protein integrity .

• Working Stock: For ongoing experiments, maintain working aliquots at 4°C for up to one week to minimize freeze-thaw damage .

• Reconstitution Recommendations: When using lyophilized preparations, reconstitute to 0.1-1.0 mg/mL in deionized sterile water, then add glycerol to a final concentration of 50% for storage .

Researchers should verify protein stability under their specific storage conditions using activity assays or structural analyses when establishing a new batch of protein preparations.

How should researchers reconstitute lyophilized VV1_2222 protein for experimental use?

Proper reconstitution of lyophilized UPF0208 membrane protein VV1_2222 is essential to maintain its structural and functional integrity. The following step-by-step protocol is recommended:

• Initial Preparation:

  • Briefly centrifuge the vial containing lyophilized protein to ensure all material is at the bottom of the container

  • Allow the vial to equilibrate to room temperature before opening to prevent moisture condensation

• Reconstitution Process:

  • Add deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Gently rotate or invert the vial rather than vortexing to avoid protein denaturation

  • Allow 5-10 minutes for complete dissolution

• Post-Reconstitution Treatment:

  • For long-term storage, add glycerol to a final concentration of 50%

  • For immediate use, the protein can be diluted in appropriate experimental buffers

• Quality Verification:

  • Confirm protein concentration using appropriate methods (Bradford, BCA, or A280)

  • Assess protein integrity via SDS-PAGE if sufficient material is available

• Aliquoting Strategy:

  • Divide the reconstituted protein into single-use aliquots

  • Flash-freeze aliquots in liquid nitrogen before transferring to -80°C storage

This reconstitution approach minimizes protein degradation and maintains the highest possible biological activity for subsequent experimental applications.

What experimental approaches are suitable for studying VV1_2222 membrane insertion and topology?

Investigating the membrane insertion and topology of UPF0208 membrane protein VV1_2222 requires specialized experimental approaches that can elucidate its orientation and integration within lipid bilayers. Several complementary methodologies are recommended:

These approaches provide complementary data that, when integrated, can generate a comprehensive model of how VV1_2222 integrates into and spans the membrane.

What methods are effective for studying potential protein-protein interactions involving VV1_2222?

To investigate potential protein-protein interactions involving UPF0208 membrane protein VV1_2222, researchers should employ multiple complementary approaches that address the challenges of working with membrane proteins:

• Co-Immunoprecipitation (Co-IP) with Membrane-Compatible Detergents:

  • Use mild detergents (DDM, CHAPS, or digitonin) for solubilization

  • Employ anti-His antibodies to capture the His-tagged VV1_2222

  • Identify co-precipitating partners via mass spectrometry

• Proximity-Based Labeling:

  • BioID or APEX2 fusion to VV1_2222 for in vivo labeling of proximal proteins

  • Particularly valuable for capturing transient or weak interactions

• Microscopy-Based Approaches:

  • FRET between fluorescently labeled VV1_2222 and candidate interacting proteins

  • Bimolecular Fluorescence Complementation (BiFC) to visualize interaction complexes

• Crosslinking Mass Spectrometry:

  • Chemical crosslinking of protein complexes followed by mass spectrometry

  • Provides spatial constraints between interacting proteins and specific interacting residues

• Surface Plasmon Resonance (SPR) or Microscale Thermophoresis (MST):

  • For quantitative measurement of binding affinities

  • Requires careful buffer optimization to maintain membrane protein stability

When designing these experiments, researchers should consider the native environment of VV1_2222 in Vibrio vulnificus and incorporate appropriate controls to distinguish specific from non-specific interactions that commonly confound membrane protein interaction studies.

How can researchers assess the functional activity of recombinant VV1_2222?

Assessing the functional activity of recombinant UPF0208 membrane protein VV1_2222 presents a significant challenge since its precise biological function remains uncharacterized. Researchers should employ a multi-faceted approach to investigate potential activities:

• Liposome-Based Assays:

  • Reconstitute purified VV1_2222 into liposomes

  • Test for various transport activities (ions, small molecules)

  • Measure membrane permeability changes in the presence of different substrates

• Binding Studies:

  • Screen for interactions with potential ligands using techniques like:

    • Isothermal Titration Calorimetry (ITC)

    • Microscale Thermophoresis (MST)

    • Fluorescence-based binding assays

• Cellular Phenotype Restoration:

  • Generate VV1_2222 knockout in Vibrio vulnificus

  • Complement with recombinant VV1_2222

  • Assess restoration of cellular phenotypes

• Comparative Analysis With Homologs:

  • Identify homologs of VV1_2222 with known functions

  • Test VV1_2222 in similar functional assays

  • Perform structure-guided mutational analysis to test functional hypotheses

• Protein-Lipid Interactions:

  • Investigate specific lipid binding preferences using:

    • Lipid overlay assays

    • Liposome flotation assays

    • Native mass spectrometry with nanodiscs

Since UPF0208 is a family of proteins with unknown function, researchers should design experiments with an open mind regarding potential activities, ranging from transport functions to structural roles or signaling capabilities within bacterial membranes.

What structural biology approaches are most suitable for determining the 3D structure of VV1_2222?

Determining the three-dimensional structure of UPF0208 membrane protein VV1_2222 requires specialized approaches due to its membrane-associated nature. The following methodologies are particularly suitable:

• X-ray Crystallography with Membrane Mimetics:

  • Lipidic cubic phase (LCP) crystallization

  • Detergent micelle crystallization with careful screening of detergent types

  • Antibody fragment (Fab) co-crystallization to increase polar surface area

• Cryo-Electron Microscopy (Cryo-EM):

  • Single particle analysis for larger complexes

  • Subtomogram averaging if the protein forms ordered arrays

  • Nanodiscs or amphipols as membrane mimetics to maintain native-like environment

• Nuclear Magnetic Resonance (NMR) Spectroscopy:

  • Solution NMR with isotopically labeled protein in detergent micelles

  • Solid-state NMR of reconstituted protein in lipid bilayers

  • Particularly valuable for dynamics studies

• Integrative Structural Biology Approaches:

  • Combining low-resolution data from SAXS or SANS

  • Distance constraints from EPR spectroscopy

  • Crosslinking mass spectrometry

  • Computational modeling validated by experimental constraints

For each approach, optimization of sample preparation is critical. The choice between methods should consider the size of VV1_2222 (150 amino acids), its stability in different membrane mimetics, and the specific structural questions being addressed. A combination of complementary techniques will likely provide the most comprehensive structural understanding.

How can researchers investigate the evolutionary conservation and significance of VV1_2222?

Investigating the evolutionary conservation and significance of UPF0208 membrane protein VV1_2222 requires a multi-faceted bioinformatic and experimental approach:

• Comprehensive Sequence Analysis:

  • Perform BLAST searches against diverse bacterial genomes

  • Generate multiple sequence alignments of homologs

  • Identify highly conserved residues as potential functionally important sites

  • Map conservation patterns onto predicted secondary structure elements

• Phylogenetic Analysis:

  • Construct phylogenetic trees of UPF0208 family members

  • Compare protein phylogeny with species phylogeny to identify potential horizontal gene transfer events

  • Analyze co-evolution with interacting partners

• Genomic Context Analysis:

  • Examine neighboring genes in Vibrio vulnificus and related species

  • Identify conserved operonic structures that might suggest functional relationships

  • Search for co-occurrence patterns with other genes across diverse genomes

• Structural Homology Modeling:

  • Identify structural homologs even in the absence of high sequence similarity

  • Map conserved residues onto structural models to identify potential functional sites

  • Predict protein-protein interaction interfaces based on conservation patterns

• Experimental Validation:

  • Generate site-directed mutants of highly conserved residues

  • Test the impact of mutations on protein stability and potential functions

  • Perform complementation studies across bacterial species

This integrated approach can reveal both the evolutionary history of VV1_2222 and provide insights into its biological significance, particularly in the context of Vibrio species pathogenicity or environmental adaptation.

What advanced spectroscopic methods can characterize the conformational dynamics of VV1_2222?

Advanced spectroscopic methods offer powerful approaches to investigate the conformational dynamics of UPF0208 membrane protein VV1_2222, providing insights that static structural techniques cannot capture:

• Electron Paramagnetic Resonance (EPR) Spectroscopy:

  • Site-directed spin labeling (SDSL) at strategic positions

  • Continuous wave EPR for mobility analysis

  • DEER/PELDOR for long-range distance measurements (1.5-8 nm)

  • Reveals dynamic changes in response to environmental conditions

• Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Maps solvent accessibility and backbone dynamics

  • Can be performed in various membrane mimetics

  • Identifies regions with different conformational stabilities

  • Particularly useful for comparing states (e.g., with/without binding partners)

• Single-Molecule Förster Resonance Energy Transfer (smFRET):

  • Requires site-specific labeling with donor-acceptor fluorophore pairs

  • Provides distance information between labeled sites

  • Can capture rare conformational states and kinetic transitions

  • Suitable for real-time monitoring of conformational changes

• Nuclear Magnetic Resonance (NMR) Relaxation Experiments:

  • Provides atomic-resolution dynamics information

  • Requires isotopic labeling (15N, 13C)

  • Can distinguish motions on different timescales

  • Particularly informative for flexible regions

• Molecular Dynamics (MD) Simulations Validated by Experimental Data:

  • Atomistic simulations in explicit membrane environments

  • Integration with experimental restraints

  • Reveals potential conformational transitions and energy landscapes

  • Identifies water/ion pathways through the protein

These complementary approaches can collectively provide a comprehensive understanding of how VV1_2222 functions dynamically within the membrane environment, potentially revealing mechanisms of action that are not apparent from static structures alone.

How can researchers overcome solubility issues when working with recombinant VV1_2222?

Membrane proteins like UPF0208 membrane protein VV1_2222 frequently present solubility challenges during expression and purification. Researchers can implement these strategies to overcome these obstacles:

• Optimized Detergent Screening:

  • Systematically test multiple detergent classes:

    • Maltosides (DDM, UDM, DM)

    • Glucosides (OG, NG)

    • Zwitterionic detergents (LDAO, FC-12)

    • Newer amphipathic polymers (amphipols, SMALPs)

  • Utilize detergent mixtures for improved extraction efficiency

• Fusion Tag Strategies:

  • N-terminal or C-terminal solubility-enhancing tags:

    • MBP (maltose-binding protein)

    • SUMO

    • Thioredoxin

  • Use removable tags with precise protease recognition sites

• Modified Expression Protocols:

  • Cold shock expression (16-20°C)

  • Co-expression with molecular chaperones

  • Use of specialized E. coli strains designed for membrane proteins

  • Consider cell-free expression systems for difficult cases

• Alternative Membrane Mimetics:

  • Nanodiscs formation for a more native-like environment

  • Bicelles for structural studies

  • Liposome reconstitution for functional assays

• Buffer Optimization Matrix:

  • pH range (6.5-8.5)

  • Salt concentration (100-500 mM)

  • Glycerol content (5-20%)

  • Stabilizing additives (specific lipids, cholesterol hemisuccinate)

Researchers should document solubility enhancement outcomes methodically, as the optimal approach often involves a combination of strategies tailored to the specific properties of VV1_2222.

What are the common pitfalls in protein-protein interaction studies with VV1_2222 and how can they be avoided?

Protein-protein interaction studies involving membrane proteins like UPF0208 membrane protein VV1_2222 are susceptible to several common pitfalls. Here are the major challenges and strategies to overcome them:

• Non-specific Hydrophobic Interactions:

  • Pitfall: Membrane proteins can aggregate non-specifically due to exposed hydrophobic surfaces

  • Solution: Include appropriate controls (unrelated membrane proteins) and use stringent washing conditions calibrated not to disrupt legitimate interactions

• Detergent Interference:

  • Pitfall: Detergents used for solubilization can disrupt native interactions

  • Solution: Screen multiple detergents at various concentrations; consider alternatives like nanodiscs or amphipols that better preserve native interactions

• Orientation Constraints:

  • Pitfall: Immobilization strategies may sterically block interaction surfaces

  • Solution: Use multiple tagging approaches (N-terminal, C-terminal, internal tags) and compare results

• Tag-Mediated Artifacts:

  • Pitfall: Affinity tags themselves can mediate non-physiological interactions

  • Solution: Confirm interactions using tag-free approaches or with the tag in alternative positions

• Temporal Sensitivity:

  • Pitfall: Some interactions may be transient or condition-dependent

  • Solution: Employ cross-linking strategies or proximity labeling approaches (BioID, APEX) to capture transient interactions

• Buffer Composition Effects:

  • Pitfall: Interaction stability may be highly sensitive to buffer conditions

  • Solution: Systematically test various ionic strengths, pH values, and additives

• Validation Challenges:

  • Pitfall: Confirming the biological relevance of detected interactions

  • Solution: Employ orthogonal methods (co-localization, functional assays, mutagenesis of predicted interface residues)

By anticipating these challenges and implementing appropriate control strategies, researchers can generate more reliable protein-protein interaction data for VV1_2222 and other challenging membrane proteins.

How should researchers interpret contradictory results when characterizing VV1_2222?

• Methodological Differences Analysis:

  • Compare experimental conditions across contradictory studies:

    • Protein construct design (tags, truncations)

    • Expression systems used

    • Purification protocols

    • Membrane mimetics employed

  • Consider how each method's inherent limitations might bias results

• Technical Validation Framework:

  • Implement technical replications with statistical analysis

  • Use orthogonal techniques to address the same question

  • Evaluate positive and negative controls for each assay

  • Consider batch-to-batch variation in protein preparations

• Conformational State Hypothesis:

  • Explore whether contradictions might reflect different conformational states:

    • Test activity under varying conditions (pH, ionic strength)

    • Investigate ligand effects on conformation

    • Consider oligomerization states as a source of functional differences

• Systematic Error Identification:

  • Review experimental design for potential systematic errors:

    • Detergent effects on protein behavior

    • Influence of tags on protein function

    • Buffer components that might modulate activity

    • Time-dependent protein stability issues

• Integrated Data Analysis:

  • Weight evidence based on methodology robustness

  • Develop models that might reconcile seemingly contradictory results

  • Consider whether discrepancies reveal important biological insights about protein dynamics or context-dependent functions

This structured approach transforms contradictory results from obstacles into opportunities for deeper understanding of VV1_2222's complex behavior and functional mechanisms. Researchers should maintain detailed records of all experimental conditions to facilitate retrospective analysis when new information becomes available.