Recombinant UPF0208 membrane protein YfbV (yfbV)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant UPF0208 Membrane Protein YfbV (yfbV)

Recombinant UPF0208 membrane protein YfbV (yfbV) is a protein of unknown function (UPF) that has been produced through recombinant DNA technology . This protein is found in various bacterial species, including Escherichia coli and Salmonella . Recombinant YfbV proteins are often expressed in hosts like E. coli, yeast, baculovirus, or mammalian cells to facilitate research and production . The purity of these recombinant proteins is typically greater than or equal to 85%, as determined by SDS-PAGE .

General Information

PropertyDescription
NamesRecombinant UPF0208 membrane protein YfbV (yfbV); UPF0208 membrane protein YfbV; hypothetical protein
SourceVarious bacterial species, including Escherichia coli and Salmonella
Expression HostE. coli, Yeast, Baculovirus, Mammalian Cell, or Cell-Free Expression systems
Purity≥85% as determined by SDS-PAGE
Molecular Weight0
ApplicationsPrimarily used in research to elucidate its function, study its interactions, and explore its potential applications
SuppliersCUSABIO TECHNOLOGY LLC
Gene NamesyfbV

Occurrence and Characteristics

YfbV is present in several bacterial species . It is referred to as a UPF0208 membrane protein, indicating that it is a protein of unknown function with one or more transmembrane domains . The recombinant forms of YfbV are produced in various expression systems to enable detailed study and characterization .

Function and Structure

The precise function of YfbV is not yet known; it is annotated as a protein of unknown function (UPF0208) . Determining the structure and function of YfbV may require techniques such as X-ray crystallography and functional assays .

Production and Sourcing

Recombinant YfbV proteins are produced in different expression systems, including E. coli, yeast, baculovirus, and mammalian cells . These recombinant proteins are available from various suppliers, such as CUSABIO TECHNOLOGY LLC .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. To prioritize a particular tag, please specify your requirements during the ordering process.
Synonyms
yfbV; Z3556; ECs3179; UPF0208 membrane protein YfbV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
yfbV
Target Protein Sequence
MSTPDNRSVNFFSLFRRGQHYSKTWPLEKRLAPVFVENRVIKMTRYAIRFMPPIAVFTLC WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPAILNWFYEVRGKLQESGQVL APVEGKPDYQALADTLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links

KEGG: ece:Z3556

STRING: 155864.Z3556

Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Expression and Purification Methodology

Q1: What expression systems are optimal for producing recombinant YfbV, and how do they influence protein properties?

Recombinant YfbV is typically expressed in Escherichia coli or yeast, which offer higher yields and shorter production timelines compared to insect or mammalian cells . While prokaryotic systems (e.g., E. coli) are cost-effective for structural studies, eukaryotic systems (e.g., insect/mammalian cells) are critical for studying post-translational modifications (PTMs) like glycosylation or disulfide bonding . For functional assays requiring native-like activity, mammalian cell expression is preferred despite lower yields .

Q2: How are solubility challenges addressed in YfbV production?

YfbV’s hydrophobic transmembrane domains often necessitate solubilization strategies. Traditional methods rely on detergents (e.g., DDM, C12E8), but emerging approaches like de novo WRAPs (Water-soluble RFdiffused Amphipathic Proteins) stabilize helical membrane proteins in solution without detergents while preserving structural integrity . WRAPs surround hydrophobic regions, enabling solubilization of multi-pass transmembrane proteins like YfbV for downstream functional or structural studies .

Q3: What purification protocols are recommended for YfbV?

Chromatographic methods (e.g., Ni-NTA affinity, size-exclusion, or ion-exchange) are standard for His-tagged YfbV . For WRAP-solubilized YfbV, detergent-free purification via affinity tags or biotin-avidin systems may be employed . Purity (>85%) is typically assessed via SDS-PAGE .

Functional and Structural Characterization

Q4: How to validate the functional integrity of recombinant YfbV?

Functional validation requires enzymatic or binding assays. For example, if YfbV has ATPase activity, measure ATP hydrolysis rates under varying conditions . Binding assays (e.g., SPR, ELISA) can confirm interactions with ligands or membrane components . Structural studies (e.g., cryo-EM, X-ray crystallography) should align with functional data to confirm correct folding .

Q5: What structural techniques are feasible for YfbV, and what are their limitations?

Experimental Design and Data Interpretation

Q6: How to resolve conflicting results in YfbV solubility or activity assays?

Discrepancies often arise from expression system differences. For example, E. coli-expressed YfbV may lack PTMs critical for activity, while mammalian-expressed versions may show higher activity but lower purity. Systematic testing of expression hosts, solubilization agents, and assay conditions is essential. Comparative tables (e.g., Table 1) can clarify variables affecting outcomes .

Q7: What computational tools aid in YfbV research?

Homology modeling (e.g., AlphaFold) predicts YfbV’s structure, but accuracy depends on template availability. Molecular dynamics simulations assess WRAP-YfbV interactions or membrane insertion dynamics. Bioinformatics tools identify conserved motifs or potential binding sites .

Advanced Research Challenges

Q8: How to integrate cryo-EM and functional data for YfbV?

Cryo-EM maps of WRAPed YfbV provide structural insights, while functional assays validate ligand-binding sites or conformational changes. For example, a 4.0 Å map of TP0698 (a beta-barrel protein) aligned with WRAP design models, enabling targeted mutagenesis to probe functional regions .

Q9: What are the limitations of WRAP technology for YfbV?

While WRAPs enhance solubility, they may sterically hinder interactions with binding partners. Functional assays must confirm that WRAPs do not occlude active sites. Additionally, WRAP design requires computational prediction of hydrophobic surfaces, which may vary between YfbV orthologs .

Troubleshooting and Optimization

Q10: How to optimize YfbV expression in mammalian cells?

Optimization involves codon-usage adaptation, selecting inducible promoters (e.g., T7 or CMV), and co-expressing chaperones (e.g., GroEL-GroES) to enhance folding. Media additives (e.g., glycerol, sorbitol) can reduce aggregation .

Q11: What strategies address low yields in YfbV production?

Low yields in E. coli may stem from toxicity. Solutions include:

  • Tuning induction temperature: Lower temperatures (e.g., 18°C) reduce inclusion body formation.

  • Using fusion partners: MBP or GST tags can improve solubility.

  • Testing alternative strains: E. coli BL21(DE3) pLysS or E. coli Rosetta strains enhance disulfide bridge formation .

Table 1: Expression System Comparison for Recombinant YfbV

SystemYieldPTMsSolubilityCost
E. coliHighNoneLow (detergent-dependent)Low
YeastModerateLimitedModerateModerate
Insect CellsLowFullModerateHigh
Mammalian CellsVery LowFullHigh (WRAP-dependent)Very High

Key Recommendations

  • Basic Studies: Use E. coli for initial structural characterization; employ WRAPs for detergent-free solubilization .

  • Advanced Studies: Opt for mammalian cells to study PTMs, paired with cryo-EM for structural validation .

  • Conflict Resolution: Systematically vary expression hosts and solubilization methods to isolate variables causing discrepancies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.