Recombinant UPF0208 membrane protein YPO2564/y1623/YP_2375 (YPO2564, y1623, YP_2375)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant UPF0208 membrane protein YPO2564/y1623/YP_2375 is a protein associated with Yersinia pestis . It is also referred to as UPF0208 membrane protein YPO2564/y1623/YP_2375, with synonyms including YPO2564, y1623, and YP_2375 .

Characteristics

  • Source: Typically expressed in E. coli .

  • Tag: Often comes with an N-terminal His tag for purification purposes .

  • Protein Length: Full Length (1-151 amino acids) .

  • Form: Usually available as a lyophilized powder .

  • Purity: Generally greater than 85% or 90% as determined by SDS-PAGE .

  • UniProt ID: Q8ZDJ8 .

Available Forms

Recombinant UPF0208 membrane protein YPO2564/y1623/YP_2375 is available with a His-tag . It can be expressed and purified from different hosts .

Applications

This recombinant protein is intended for research purposes, particularly in studying membrane proteins and their functions.

Related UPF0208 Membrane Proteins

UPF0208 membrane proteins are found in various bacterial species, including:

OrganismProtein Name(s)
Escherichia coliYfbV (yfbV), EcolC_1357
Haemophilus influenzaeHI_1205 (HI_1205)
Klebsiella pneumoniaeKPN78578_26420 (KPN78578_26420), yfbV
Salmonella gallinarumYfbV (yfbV), SG2365
Salmonella paratyphi CYfbV (yfbV), SPC_1372
Salmonella schwarzengrundYfbV (yfbV), SeSA_A2564
Serratia proteamaculansSpro_3315 (Spro_3315)
Vibrio splendidusVS_0999 (VS_0999)
Aliivibrio salmonicidaVSAL_I2111 (VSAL_I2111)
Yersinia enterocoliticaYE1335 (YE1335)
Yersinia pestisYPDSF_1972 (YPDSF_1972), YpAngola_A1824 (YpAngola_A1824)
Yersinia pseudotuberculosisYpsIP31758_1444 (YpsIP31758_1444), YPTS_2690 (YPTS_2690), YPK_1552 (YPK_1552)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YPO2564; y1623; YP_2375; UPF0208 membrane protein YPO2564/y1623/YP_2375
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Yersinia pestis
Target Names
YPO2564
Target Protein Sequence
MTIKPSDSVSWFQVLQRGQHYMKTWPADKRLAPVFPENRVTVVTRFGIRFMPPLAIFTLT WQIALGGQLGPAIATALFACGLPLQGLWWLGKRAITPLPPTLLQWFHEVRHKLFEAGQAV APIEPIPTYQSLADLLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links

KEGG: ype:YPO2564

STRING: 187410.y1623

Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant UPF0208 membrane protein YPO2564/y1623/YP_2375?

Recombinant UPF0208 membrane protein YPO2564/y1623/YP_2375 is a bacterial membrane protein associated with Yersinia pestis, the causative agent of plague. The UPF0208 designation indicates it belongs to a family of proteins with uncharacterized protein function, suggesting its biological role remains to be fully elucidated. This recombinant version is specifically engineered for research applications, typically incorporating tags for purification and detection purposes. The protein is frequently produced with an N-terminal His tag to facilitate isolation using affinity chromatography methods. Research with this recombinant protein aims to better understand membrane protein functions in bacterial systems, particularly those related to pathogenicity or essential cellular processes.

What bacterial species express UPF0208 membrane proteins?

UPF0208 membrane proteins demonstrate significant conservation across multiple bacterial species, suggesting important functional roles in bacterial physiology. The distribution spans several clinically relevant genera including:

OrganismProtein Name(s)
Escherichia coliYfbV (yfbV), EcolC_1357
Haemophilus influenzaeHI_1205 (HI_1205)
Klebsiella pneumoniaeKPN78578_26420 (KPN78578_26420), yfbV
Salmonella gallinarumYfbV (yfbV), SG2365
Salmonella paratyphi CYfbV (yfbV), SPC_1372
Salmonella schwarzengrundYfbV (yfbV), SeSA_A2564
Serratia proteamaculansSpro_3315 (Spro_3315)
Vibrio splendidusVS_0999 (VS_0999)
Aliivibrio salmonicidaVSAL_I2111 (VSAL_I2111)
Yersinia enterocoliticaYE1335 (YE1335)
Yersinia pestisYPDSF_1972 (YPDSF_1972), YpAngola_A1824 (YpAngola_A1824)
Yersinia pseudotuberculosisYpsIP31758_1444 (YpsIP31758_1444), YPTS_2690 (YPTS_2690), YPK_1552 (YPK_1552)

This phylogenetic distribution provides valuable comparative research opportunities, enabling evolutionary studies and functional analyses across species. Researchers investigating bacterial membrane biology often leverage this conservation to develop model systems using more tractable organisms before extending findings to pathogens like Y. pestis.

What are the common nomenclature variants for this protein?

The protein is referenced in scientific literature and databases using multiple nomenclature variants, which can complicate literature searches and data integration. Common synonyms include:

  • YPO2564 (primary locus tag in Y. pestis CO92 strain)

  • y1623 (alternative locus designation)

  • YP_2375 (protein accession number)

  • UPF0208 membrane protein (family designation)

Additionally, homologs in other Yersinia pestis strains have separate identifiers, including YPDSF_1972 and YpAngola_A1824. When conducting literature reviews or database searches, researchers should incorporate all known nomenclature variants to ensure comprehensive coverage of relevant publications. This multi-name approach is especially important when constructing systematic reviews or meta-analyses of functional studies.

What expression systems are optimal for recombinant UPF0208 membrane protein production?

Selection of appropriate expression systems significantly impacts both yield and functionality of recombinant UPF0208 membrane proteins . Several host systems offer distinct advantages:

The optimal expression system selection depends on research objectives: structural studies may prioritize yield (favoring E. coli), while functional analyses may require appropriate posttranslational modifications (favoring mammalian or insect cells) . For UPF0208 membrane proteins, initial characterization often employs prokaryotic systems, with subsequent validation in more complex eukaryotic systems to confirm physiological relevance.

How should researchers design experiments to evaluate UPF0208 membrane protein function?

Robust experimental design is crucial for generating valid, reliable data regarding UPF0208 membrane protein function . Single-subject experimental designs (SSEDs) provide a valuable approach for investigating these proteins, particularly when:

  • Establishing baseline measurements: Any functional assessment should begin with a stable baseline phase with minimal variability and absence of improvement trends . For UPF0208 proteins, this might involve measuring membrane integrity, transport activity, or protein-protein interactions under standard conditions before experimental manipulation.

  • Controlling intervention variables: The independent variable (e.g., protein concentration, mutation, binding partner) must be actively manipulated by the researcher rather than changing due to external factors . This control is essential for establishing causality in function studies.

  • Systematic measurement of dependent variables: Functional outcomes must be measured consistently across experimental phases, preferably by multiple assessors to ensure reliability . Interassessor agreement should be established for at least 20% of data points in each experimental phase.

  • Sufficient data collection: Each experimental phase should include at least 5 data points to meet standard criteria, though 3-4 points may be acceptable with reservations . This requirement ensures sufficient statistical power to detect meaningful functional changes.

  • Replication of effects: Any observed functional changes must be replicated at least three times to establish validity . This replication reduces the likelihood that observed effects result from random variation or experimental artifacts.

How can researchers address data contradictions in UPF0208 membrane protein studies?

Contradictory findings are common in membrane protein research and require systematic approaches to resolution . When confronting inconsistent results regarding UPF0208 membrane proteins, researchers should:

  • Examine baseline stability: Unstable baseline data with significant variability or trending can lead to misinterpretation of intervention effects . As illustrated in experimental design literature, high variability in baseline measurements (e.g., ranging from 0% to 100%) compromises the ability to attribute changes to specific interventions .

  • Evaluate latency effects: When changes in protein function don't immediately follow experimental manipulation, this suggests either delayed effects or potential influence of extraneous variables . True experimental effects should demonstrate reliable temporal relationships with interventions across replications.

  • Consider pre-existing trends: An increasing trend during baseline that continues during intervention phase may be misinterpreted as an intervention effect . Researchers must distinguish between natural progression and true intervention effects through extended baseline measurements and appropriate controls.

  • Implement visual analysis techniques: Systematic visual analysis of graphed data helps identify overlaps between phases, level changes, trend changes, and variability differences . This approach provides a foundation for determining whether contradictions stem from methodological differences or represent true biological variability.

  • Apply quality assessment criteria: Frameworks like those developed by the What Works Clearinghouse (WWCH) panel provide standardized criteria for evaluating experimental evidence quality . These criteria help researchers reconcile contradictory findings by weighting evidence according to methodological rigor.

By applying these analytical approaches, researchers can more effectively interpret seemingly contradictory findings about UPF0208 membrane protein structure, function, or expression patterns across different experimental systems or bacterial species.

What purification strategies yield highest purity for UPF0208 membrane proteins?

Purification of UPF0208 membrane proteins to high homogeneity requires specialized strategies due to their hydrophobic nature and embedding within lipid bilayers . Most effective approaches include:

  • Affinity chromatography: The N-terminal His tag commonly incorporated in recombinant UPF0208 membrane proteins enables efficient isolation using immobilized metal affinity chromatography (IMAC). This approach typically employs nickel or cobalt resins with imidazole gradient elution to minimize non-specific binding.

  • Detergent selection: Critical for membrane protein extraction and maintaining solubility throughout purification . Mild detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) are commonly employed to balance extraction efficiency with preservation of native protein structure.

  • Size exclusion chromatography: Valuable as a secondary purification step to separate monomeric protein from aggregates and remove detergent micelles. This technique also provides preliminary information about oligomerization state and homogeneity.

How can researchers validate expression and structural integrity of recombinant UPF0208 membrane proteins?

Validation of proper expression and structural integrity is essential before functional characterization of UPF0208 membrane proteins . Comprehensive validation employs multiple complementary techniques:

  • SDS-PAGE and Western blotting: Provides confirmation of protein expression at expected molecular weight and preliminary purity assessment. Anti-His antibodies can detect the N-terminal tag commonly incorporated in recombinant constructs.

  • Mass spectrometry: Enables precise identification of the protein and detection of any post-translational modifications or proteolytic processing . Top-down proteomics approaches can verify intact protein mass, while bottom-up methods provide sequence coverage confirmation.

  • Circular dichroism (CD) spectroscopy: Assesses secondary structure content to verify proper folding, particularly important when comparing proteins expressed in different host systems . Alpha-helical content is typically high in properly folded membrane proteins.

  • Fluorescence spectroscopy: Intrinsic tryptophan fluorescence provides information about tertiary structure and can detect major conformational changes in different detergent or lipid environments .

  • Thermal stability assays: Techniques like differential scanning fluorimetry (DSF) can assess protein stability and identify conditions that enhance structural integrity . Properly folded membrane proteins typically exhibit cooperative unfolding transitions.

Researchers should implement multiple validation techniques, as reliance on a single method may miss significant structural defects that could impact functional analyses. These validation steps are particularly important when comparing UPF0208 homologs from different bacterial species or when expressing the same protein in different host systems.

What strategies maximize expression yields across different host systems?

Maximizing expression yields for UPF0208 membrane proteins requires system-specific optimization strategies . Key approaches include:

  • E. coli optimization:

    • Utilize specialized strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3))

    • Employ tight promoter control to prevent toxicity from overexpression

    • Lower induction temperature (16-25°C) to slow expression and facilitate proper folding

    • Supplement with rare codons through specialized strains or co-expression of rare tRNA genes

  • Yeast optimization:

    • Select appropriate promoters (constitutive vs. inducible) based on protein toxicity

    • Optimize methanol induction protocols for Pichia pastoris systems

    • Control growth density at induction to balance biomass with expression efficiency

    • Implement fed-batch fermentation to achieve higher cell densities and protein yields

  • Insect cell optimization:

    • Optimize virus:cell ratio for baculovirus infection

    • Determine optimal harvest timing to balance expression level with protein quality

    • Consider co-expression of chaperones to enhance proper folding

    • Evaluate different cell lines (Sf9, Sf21, High Five™) for highest expression

  • Mammalian cell optimization:

    • Test transient versus stable expression for specific UPF0208 proteins

    • Implement codon optimization for mammalian expression

    • Consider inducible expression systems for potentially toxic membrane proteins

    • Evaluate suspension culture systems for scale-up potential

What are the key research priorities for advancing UPF0208 membrane protein understanding?

Future research on UPF0208 membrane proteins should address several critical knowledge gaps to advance understanding of this protein family . Priority areas include:

  • Structural characterization: Despite conservation across bacterial species, detailed structural information remains limited. High-resolution structures through X-ray crystallography or cryo-electron microscopy would provide insights into functional mechanisms and potential interaction surfaces.

  • Functional elucidation: The "uncharacterized protein family" designation indicates incomplete understanding of biological functions. Systematic knockout/knockdown studies combined with phenotypic assessments across bacterial species could identify essential roles and species-specific functions.

  • Interaction partner identification: Membrane proteins often function within complexes or signaling networks . Proteomic approaches including co-immunoprecipitation, proximity labeling, and two-hybrid screens could identify interaction partners providing functional insights.

  • Post-translational modification characterization: Different expression systems provide varying post-translational modifications that may affect function . Comparative studies using mass spectrometry to identify modifications across expression systems could clarify their functional significance.

  • Evolutionary analysis: The presence of UPF0208 homologs across diverse bacterial species suggests evolutionary conservation. Phylogenetic analyses and evolutionary rate studies could identify conserved functional domains versus species-specific adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.