Recombinant UPF0208 membrane protein YPTB2595 (YPTB2595)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
YPTB2595; UPF0208 membrane protein YPTB2595
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype I (strain IP32953)
Target Names
YPTB2595
Target Protein Sequence
MTIKPSDSVSWFQVLQRGQHYMKTWPADKRLAPVFPENRVTVVTRFGIRFMPPLAIFTLT WQIALGGQLGPAIATALFACGLPLQGLWWLGKRAITPLPPTLLQWFHEVRHKLSEAGQAV APIEPIPTYQSLADLLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links
Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for recombinant YPTB2595 production?

The recombinant YPTB2595 protein is successfully expressed in E. coli expression systems . For membrane proteins like YPTB2595, several methodological considerations are important:

  • Expression strain selection: BL21(DE3) or derivatives are commonly used for membrane protein expression, with modifications such as C41(DE3) or C43(DE3) strains that can better tolerate membrane protein overexpression.

  • Expression conditions: Lower temperatures (16-25°C) often improve proper folding of membrane proteins.

  • Induction parameters: Lower IPTG concentrations (0.1-0.5 mM) and longer expression times may increase yields of properly folded protein.

  • Membrane fraction isolation: Methods such as ultracentrifugation or differential centrifugation are essential to isolate membrane fractions containing the target protein.

Based on the available information, the YPTB2595 protein can be successfully expressed as a His-tagged fusion protein in E. coli, resulting in a purified product with greater than 90% purity as determined by SDS-PAGE .

What are the optimal purification strategies for YPTB2595 to maintain structural integrity?

Purification of membrane proteins like YPTB2595 requires careful consideration of detergents and buffer conditions. The N-terminal His-tag on recombinant YPTB2595 facilitates purification via immobilized metal affinity chromatography (IMAC) . An optimal purification strategy would include:

  • Membrane solubilization:

    • Select appropriate detergents (e.g., DDM, LDAO, or Triton X-100)

    • Optimize detergent concentration to solubilize without denaturing

  • IMAC purification:

    • Use Ni-NTA or cobalt-based resins

    • Include low concentrations of detergent in all buffers

    • Consider adding glycerol (5-10%) to stabilize the protein

  • Further purification:

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography if additional purity is required

  • Quality control:

    • SDS-PAGE analysis (>90% purity expected)

    • Western blotting with anti-His antibodies

The purified YPTB2595 is typically obtained as a lyophilized powder, which should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with the addition of 5-50% glycerol for long-term storage stability .

What techniques are most effective for determining the topology and structure of YPTB2595?

For membrane proteins like YPTB2595, a combination of computational and experimental approaches provides the most comprehensive structural insights:

  • Computational predictions:

    • Transmembrane domain prediction (TMHMM, Phobius)

    • Secondary structure prediction (PSIPRED, JPred)

    • Homology modeling if structural homologs exist

  • Experimental techniques:

    • Circular dichroism (CD) spectroscopy for secondary structure estimation

    • Site-directed mutagenesis coupled with accessibility assays

    • Limited proteolysis to identify exposed regions

    • Cysteine scanning mutagenesis

  • Advanced structural techniques:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy

    • NMR spectroscopy for smaller membrane proteins or domains

Since YPTB2595 is a relatively small membrane protein (151 amino acids), it may be amenable to solution NMR studies if properly solubilized in detergent micelles or reconstituted into nanodiscs.

How can researchers investigate potential protein-protein interactions of YPTB2595?

Investigating protein-protein interactions for membrane proteins like YPTB2595 requires specialized approaches:

  • Pull-down assays:

    • Leverage the His-tag on recombinant YPTB2595

    • Perform pull-downs from bacterial lysates to identify binding partners

  • Protein-fragment complementation assays (PCA):

    • Similar to those used for Raf RBD

    • Can be adapted for membrane proteins using appropriate transmembrane reporters

  • Cross-linking coupled with mass spectrometry:

    • Chemical cross-linking to capture transient interactions

    • MS/MS analysis to identify cross-linked peptides

  • Bacterial two-hybrid systems:

    • Modified for membrane proteins (e.g., BACTH system)

    • Can identify interactions with other membrane or cytosolic proteins

  • Co-immunoprecipitation:

    • Using antibodies against the His-tag

    • Western blotting to confirm interacting partners

These methods could help establish whether YPTB2595 participates in protein complexes within the bacterial membrane, potentially providing insights into its biological function.

What approaches can be used to investigate the potential functions of YPTB2595?

Since YPTB2595 belongs to a family of proteins with unknown function (UPF0208), systematic approaches to functional characterization are necessary:

  • Comparative genomics:

    • Analyze gene neighborhood in Y. pseudotuberculosis genome

    • Identify conserved co-occurrence patterns with genes of known function

  • Gene knockout studies:

    • Generate YPTB2595 deletion mutants in Y. pseudotuberculosis

    • Phenotypic characterization under various growth conditions

  • Transcriptomic analysis:

    • RNA-seq to identify conditions that alter YPTB2595 expression

    • Co-expression networks to predict functional associations

  • Lipidomic/metabolomic analyses:

    • Identify changes in membrane composition or metabolite profiles in knockout strains

    • Could reveal involvement in specific metabolic pathways

  • Transport assays:

    • If YPTB2595 functions as a transporter, reconstitute into liposomes

    • Test transport of various substrates (ions, small molecules)

These approaches, while not specific to YPTB2595 in the literature, represent methodological strategies used successfully for characterizing other membrane proteins of unknown function.

How can researchers determine if YPTB2595 is involved in virulence or pathogenicity of Yersinia pseudotuberculosis?

Given that YPTB2595 comes from a pathogenic bacterium, investigating its potential role in virulence requires specialized approaches:

  • Infection models:

    • Compare wild-type and YPTB2595 knockout strains in cell culture infections

    • Analyze invasion, adhesion, and intracellular survival

  • Animal infection studies:

    • Mouse models of Y. pseudotuberculosis infection

    • Comparing bacterial loads, tissue tropism, and host immune responses

  • Transcriptional regulation analysis:

    • Determine if YPTB2595 expression changes during infection

    • Identify potential regulators (e.g., PhoP/PhoQ, OmpR/EnvZ)

  • Stress response characterization:

    • Test sensitivity to host-relevant stresses (pH, antimicrobial peptides)

    • Analyze membrane integrity under stress conditions

  • Bacterial two-hybrid screening:

    • Identify interactions with known virulence factors

    • Could reveal involvement in virulence-associated complexes

These methodological approaches would help establish whether YPTB2595 contributes to the pathogenic lifestyle of Y. pseudotuberculosis.

How can massive sequence perturbation approaches be applied to study YPTB2595 structure-function relationships?

Massive sequence perturbation, as described in the literature for other proteins, could be applied to YPTB2595 to determine sequence-structure-function relationships :

  • Library design strategy:

    • Segment the YPTB2595 sequence based on predicted secondary structure

    • Systematically degenerate 4-7 residue segments using NNK codons

    • Maintain key structural residues as fixed points if necessary

  • Selection methods:

    • Design a function-based selection system (e.g., complementation assay)

    • For membrane proteins, consider specialized two-component or PCA systems adapted for membrane proteins

  • Sequence analysis:

    • Calculate positional entropy for each residue position

    • Identify positions with low entropy (conservation) versus high entropy (tolerance to mutation)

    • Compare experimental data with natural sequence alignments

  • Structural interpretation:

    • Map conservation patterns onto predicted structural models

    • Identify hierarchical organization of residue conservation (inner core versus outer core)

This approach would generate a "signature sequence" for YPTB2595, revealing positions critical for structural integrity versus those allowing variability .

What reconstitution systems are most appropriate for functional studies of purified YPTB2595?

For functional studies of membrane proteins like YPTB2595, several reconstitution systems offer advantages:

  • Proteoliposomes:

    SystemAdvantagesLimitationsApplications
    Unilamellar vesiclesSimple preparation, control over lipid compositionLimited stabilityTransport assays, binding studies
    Giant unilamellar vesiclesVisualization by microscopy, micromanipulation possibleTechnical complexitySingle-molecule studies, lateral diffusion
    Multilamellar vesiclesHigh protein-to-lipid ratioHeterogeneous populationSolid-state NMR studies
  • Nanodiscs:

    • Provide a native-like membrane environment

    • Stable, monodisperse particles amenable to many biophysical techniques

    • Allow study of both sides of the membrane protein

  • Amphipols:

    • Stabilize membrane proteins in detergent-free solutions

    • Compatible with many biophysical techniques

  • Supported lipid bilayers:

    • Allow surface-sensitive techniques (AFM, SPR)

    • Can be combined with microfluidics for high-throughput studies

The choice of reconstitution system depends on the specific research question. For initial functional characterization of YPTB2595, proteoliposomes with lipid compositions mimicking Y. pseudotuberculosis membranes would be a reasonable starting point.

What are the optimal storage conditions for maintaining YPTB2595 stability and activity?

Based on the provided information, YPTB2595 requires specific storage conditions to maintain stability :

  • Short-term storage:

    • Store working aliquots at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles

  • Long-term storage:

    • Store at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use

    • Store in Tris/PBS-based buffer, pH 8.0, containing 6% Trehalose

  • Reconstitution protocol:

    • Briefly centrifuge vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (default recommendation is 50%)

    • Aliquot for long-term storage at -20°C/-80°C

  • Stability assessment methods:

    • Size exclusion chromatography to monitor aggregation

    • Activity assays (once function is determined)

    • Circular dichroism to assess structural integrity

Proper storage is particularly important for membrane proteins like YPTB2595, as they tend to aggregate and lose activity more readily than soluble proteins.

How can researchers assess and improve the stability of YPTB2595 for long-term structural and functional studies?

For enhanced stability of YPTB2595 in research applications, consider these methodological approaches:

  • Stabilizing additives screening:

    AdditiveTypical ConcentrationMechanism
    Glycerol5-50%Prevents aggregation, stabilizes hydrophobic regions
    Trehalose5-10%Stabilizes protein in freeze-dried state
    Specific lipids0.1-1 mg/mLProvides native-like environment
    Cholesterol derivatives0.01-0.1%Stabilizes membrane protein structure
  • Engineering approaches:

    • Thermostabilizing mutations identified through alanine scanning

    • Removal of flexible regions that may promote aggregation

    • Introduction of disulfide bonds to stabilize tertiary structure

  • Formulation optimization:

    • Systematic screening of pH (typically pH 6.5-8.0)

    • Ionic strength optimization

    • Detergent or lipid composition fine-tuning

  • Stability monitoring methods:

    • Thermal shift assays adapted for membrane proteins

    • Limited proteolysis to assess conformational stability

    • Size exclusion chromatography to monitor oligomeric state

These approaches can significantly improve the stability of membrane proteins like YPTB2595, enabling more extended and reliable experimental investigations.

What biophysical techniques are most suitable for studying YPTB2595 membrane insertion and topology?

Understanding the membrane topology of YPTB2595 requires specialized biophysical approaches:

  • Site-directed fluorescence labeling:

    • Introduce single cysteine residues at different positions

    • Label with environment-sensitive fluorophores

    • Monitor accessibility and environmental polarity

  • EPR spectroscopy with spin labeling:

    • Attach spin labels to cysteine residues

    • Determine accessibility to paramagnetic reagents

    • Map membrane-embedded versus exposed regions

  • FRET-based distance measurements:

    • Dual labeling with donor/acceptor fluorophores

    • Determine intramolecular distances to constrain structural models

    • Monitor conformational changes

  • Hydrogen-deuterium exchange mass spectrometry:

    • Identify regions protected from exchange (membrane-embedded)

    • Reveals dynamic aspects of protein structure

  • Protease protection assays:

    • Reconstitute protein in proteoliposomes

    • Treat with proteases in presence/absence of detergents

    • Identify protected fragments by mass spectrometry

These techniques provide complementary information about YPTB2595's membrane topology and could resolve questions about the number and orientation of transmembrane segments.

How can researchers investigate the potential oligomeric state of YPTB2595?

Determining the oligomeric state of membrane proteins like YPTB2595 requires specialized approaches:

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS):

    • Determines absolute molecular weight independent of shape

    • Can distinguish between protein, detergent, and lipid contributions

  • Analytical ultracentrifugation:

    • Sedimentation velocity experiments

    • Sedimentation equilibrium to determine association constants

  • Chemical cross-linking:

    • Membrane-permeable cross-linkers with different spacer lengths

    • Mass spectrometry to identify cross-linked residues

    • Reveals proximity relationships in oligomeric assemblies

  • Single-molecule techniques:

    • Fluorescence correlation spectroscopy

    • Single-molecule photobleaching step analysis

    • Direct visualization of oligomeric state

  • Native mass spectrometry:

    • Specialized techniques for membrane proteins

    • Preserves non-covalent interactions

    • Directly measures masses of intact complexes

These methods could determine whether YPTB2595 functions as a monomer or forms higher-order assemblies, providing insights into its potential functional mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.