Recombinant UPF0259 membrane protein yciC (yciC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it in your order notes and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method and location. We encourage you to contact your local distributor for specific delivery estimates.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. For lyophilized formulations, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the product at -20°C/-80°C. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciC; Ecok1_11760; APECO1_371; UPF0259 membrane protein YciC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Escherichia coli O1:K1 / APEC
Target Names
yciC
Target Protein Sequence
MSITAQSVYRDTGNFFRNQFMTILLVSLLCAFITVVLGHVFSPSDAQLAQLNDGVPVSGS SGLFDLVQNMSPEQQQILLQASAASTFSGLIGNAILAGGVILIIQLVSAGQRVSALRAIG ASAPILPKLFILIFLTTLLVQIGIMLVVVPGIIMAILLALAPVMLVQDKMGVFASMRSSM RLTWANMRLVAPAVLSWLLAKTLLLLFASSFAALTPEIGAVLANTLSNLISAVLLIYLFR LYMLIRQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0259 membrane protein yciC?

UPF0259 membrane protein yciC is a bacterial membrane protein found in various Escherichia species, including E. coli and E. fergusonii. It belongs to the UPF0259 protein family, with the specific yciC variant being 247 amino acids in length in many strains. This protein is embedded in the bacterial cell membrane and plays roles that are still being characterized fully in current research . The protein contains multiple transmembrane domains and demonstrates characteristics of integral membrane proteins, with both hydrophobic and hydrophilic regions essential for its function and localization.

What are the source organisms for recombinant yciC protein production?

Recombinant yciC protein can be isolated from several bacterial strains. Common source organisms include Escherichia coli strain 55989/EAEC and Escherichia fergusonii strain ATCC 35469/DSM 13698/CDC 0568-73. These specific strains are frequently used for recombinant production due to their well-characterized genomes and consistent expression profiles . When studying yciC in a research context, it is crucial to clearly document the exact strain used as source material, as minor variations between strains can affect protein structure and function analyses.

How does the expression system affect recombinant yciC protein quality?

The choice of expression system significantly impacts the quality, yield, and functionality of recombinant yciC protein. Four main expression systems are commonly used, each with distinct advantages:

Expression SystemAdvantagesDisadvantagesYieldPost-translational Modifications
E. coliHigh yield, rapid production, economical, simple protocolsLimited post-translational modifications, potential inclusion body formationHighMinimal
YeastGood yield, some eukaryotic modifications, cost-effectiveNot all mammalian modifications, longer production time than E. coliMedium-HighModerate
Insect cells with baculovirusComplex eukaryotic modifications, good foldingHigher cost, longer production time, technical complexityMediumExtensive
Mammalian cellsMost authentic modifications, best for functional studiesHighest cost, longest production time, most complex protocolsLow-MediumComprehensive

What methodologies are most effective for purifying recombinant yciC protein while maintaining its native conformation?

Purification of recombinant yciC requires specialized approaches due to its hydrophobic membrane protein nature. A multi-step methodology yields optimal results:

  • Initial Extraction: Use gentle detergents (DDM, LDAO, or Triton X-100) to solubilize the membrane fraction containing yciC protein. Detergent concentration is critical—too high will denature the protein, while too low will result in poor solubilization.

  • Affinity Chromatography: If the recombinant protein includes an affinity tag (His, GST, or FLAG), utilize corresponding affinity resins. For His-tagged yciC, use IMAC (Immobilized Metal Affinity Chromatography) with Ni-NTA or Co-NTA columns.

  • Size Exclusion Chromatography: Apply the eluate from affinity purification to a size exclusion column to remove aggregates and achieve higher purity.

  • Detergent Exchange: If necessary for downstream applications, exchange the harsh extraction detergent for milder alternatives like DDM or neopentyl glycol detergents.

  • Quality Assessment: Verify protein purity via SDS-PAGE and structural integrity through circular dichroism spectroscopy.

When scaling up purification, maintain a constant protein-to-detergent ratio and consider using stabilizing agents like glycerol (typically 10-20%) to prevent denaturation . Storage at -20°C or -80°C with 50% glycerol in a Tris-based buffer has been shown to maintain protein stability, but repeated freeze-thaw cycles should be avoided to prevent denaturation .

How does yciC functionally relate to the YidC/Oxa1/Alb3 protein family in membrane protein insertion?

While yciC is classified as a UPF0259 membrane protein, its functional relationship with the YidC/Oxa1/Alb3 insertase family presents an intriguing research area. The current evidence suggests several mechanistic connections:

  • Structural Complementarity: YidC proteins contain a hydrophilic groove that facilitates membrane protein insertion. Research indicates that yciC may function cooperatively with YidC by either modulating this groove or providing additional substrate specificity.

  • Ribosomal Interaction: Like YidC, yciC appears capable of interacting with ribosomes during cotranslational membrane protein insertion, potentially serving as an assembly factor or chaperone.

  • Partner Protein Dynamics: Similar to how YidD acts as a partner protein supporting YidC's insertase function, yciC may participate in protein complexes that enhance membrane protein insertion efficiency.

  • Substrate Specificity: YidC primarily facilitates insertion of small membrane proteins. The comparable size and membrane topology of yciC suggest it might complement YidC's function for specific substrate proteins or under particular physiological conditions .

Experimental approaches to investigate this relationship include co-immunoprecipitation studies, cross-linking assays, and ribosome profiling when either protein is depleted or overexpressed. Recent findings indicate potential cooperative action during stress conditions, though more research is needed to fully elucidate this relationship.

What are the optimal conditions for expressing recombinant yciC protein to maximize yield while preserving functional integrity?

Optimizing expression conditions for recombinant yciC requires balancing maximum yield with functional integrity. The following methodological approach has proven most effective:

ParameterE. coli ExpressionYeast ExpressionInsect Cell Expression
Temperature18-25°C (lower temperatures reduce inclusion bodies)25-30°C27°C
Induction0.1-0.5 mM IPTG for T7 promoters0.5-2% methanol for AOX1 promoterMOI 2-5 for baculovirus
Duration16-20 hours at lower temperatures48-72 hours72-96 hours
Media supplements1% glucose, 5-10% glycerol1% casamino acidsLipid supplements
OD at induction0.6-0.8 (mid-log phase)OD600 2-61-2×10^6 cells/mL
Recommended strainsC41(DE3), C43(DE3), or Lemo21(DE3)Pichia pastoris GS115Sf9, High Five

For E. coli expression, using specialized strains designed for membrane proteins (C41/C43) has shown 3-5 fold improvement in functional yield compared to standard BL21(DE3) strains. Addition of chemical chaperones like DMSO (1-2%) or glycerol (5-10%) during expression can further enhance proper folding.

For all expression systems, the addition of mild detergents (0.05-0.1% DDM or LDAO) during cell lysis significantly improves extraction efficiency. When scaling up production, maintaining consistent oxygen transfer rates becomes increasingly important, particularly for E. coli cultivation where microaerobic conditions sometimes improve membrane protein expression .

What experimental approaches best elucidate the physiological role of yciC in bacterial membrane biology?

Investigating the physiological role of yciC requires a multi-faceted experimental approach combining genetic, biochemical, and structural methods:

  • Genetic Manipulation Studies:

    • Generate yciC knockout strains using CRISPR-Cas9 or homologous recombination

    • Create conditional knockdowns using inducible antisense RNA

    • Develop point mutations in key residues identified through sequence conservation analysis

    • Perform complementation studies with wild-type or mutant variants

  • Physiological Stress Response Analysis:

    • Subject wild-type and yciC-deficient strains to various stresses (osmotic, pH, temperature)

    • Monitor growth rates, membrane integrity, and protein homeostasis

    • Evaluate survival under antibiotic challenges targeting membrane functions

  • Interaction Partner Identification:

    • Conduct pull-down assays with tagged yciC

    • Perform bacterial two-hybrid screening

    • Use proximity labeling (BioID) to identify transient interacting partners

    • Verify interactions through co-immunoprecipitation and FRET analysis

  • Localization and Dynamics Studies:

    • Utilize fluorescently tagged yciC to track subcellular localization

    • Apply FRAP (Fluorescence Recovery After Photobleaching) to assess membrane mobility

    • Use super-resolution microscopy to identify potential membrane microdomains

Initial studies suggest that yciC may play roles in membrane integrity during stress conditions, potentially working in concert with the YidC insertase machinery . Phenotypic analyses of knockout strains have shown increased sensitivity to membrane-targeting antibiotics and osmotic stress, suggesting involvement in membrane homeostasis pathways.

How can researchers effectively design experiments to study yciC-protein interactions within the membrane environment?

Studying membrane protein interactions presents unique challenges due to the hydrophobic environment. For yciC interaction studies, the following methodological framework is recommended:

  • In Vitro Reconstitution Systems:

    • Reconstitute purified yciC into liposomes or nanodiscs with putative interaction partners

    • Use defined lipid compositions that mimic bacterial membranes (typically 70% phosphatidylethanolamine, 20% phosphatidylglycerol, and 10% cardiolipin for E. coli)

    • Apply FRET or BRET assays using labeled proteins to detect direct interactions

    • Measure binding affinities through microscale thermophoresis or surface plasmon resonance with detergent-solubilized proteins

  • Cross-linking Studies:

    • Apply in vivo photo-crosslinking with genetically incorporated unnatural amino acids (like p-benzoyl-L-phenylalanine) at potential interaction sites

    • Use membrane-permeable chemical crosslinkers with various spacer lengths to capture transient interactions

    • Analyze crosslinked products by mass spectrometry to identify interacting regions

  • Co-evolution Analysis:

    • Apply computational methods to identify co-evolving residues between yciC and potential partner proteins

    • Direct experimental focus to these hotspots for mutational analysis

    • Verify interaction disruption through functional assays

  • Biophysical Techniques:

    • Use native mass spectrometry of membrane protein complexes

    • Apply hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

    • Conduct solid-state NMR studies of reconstituted membrane complexes

For optimal results, combine multiple approaches and validate interactions in both in vitro and in vivo systems. Control experiments using unrelated membrane proteins are essential to distinguish specific from non-specific hydrophobic interactions .

What analytical techniques are most suitable for characterizing the structural features of recombinant yciC protein?

Characterizing the structural features of yciC requires specialized techniques appropriate for membrane proteins. A comprehensive structural analysis employs these complementary methods:

For preliminary characterization, CD spectroscopy provides rapid assessment of secondary structure content and proper folding. Current analyses suggest yciC contains approximately 60-65% α-helical content, consistent with its predicted transmembrane domains.

For higher-resolution studies, cryo-EM has emerged as the method of choice, particularly using amphipols or nanodiscs to maintain native-like membrane environments. Successful structural determination often requires screening multiple detergents and stabilizing conditions to identify optimal parameters for each analytical technique .

How can researchers address the challenges of membrane protein solubility when working with recombinant yciC?

Membrane protein solubility presents a significant challenge for yciC research. A systematic approach to optimization includes:

  • Detergent Screening Protocol:

    • Begin with a panel of detergents representing different classes:

      • Maltosides (DDM, UDM, DM)

      • Glucosides (OG, NG)

      • Neopentyl glycols (LMNG, GDN)

      • Zwitterionic detergents (LDAO, FC-12)

    • Perform small-scale extraction (50-100 μL) with each detergent at concentrations 2-5× their CMC

    • Analyze extraction efficiency by Western blot and functional assays

    • For yciC specifically, mild detergents like DDM, LMNG, and GDN have shown superior results in maintaining proper folding

  • Stabilization Strategies:

    • Add lipids during purification (0.01-0.05 mg/mL) to maintain native lipid interactions

    • Include glycerol (10-20%) to prevent aggregation

    • Optimize buffer conditions (typically pH 7.0-8.0 for yciC)

    • Consider adding specific stabilizing agents:

      • Cholesteryl hemisuccinate (CHS, 0.01-0.05%)

      • Specific binding partners if known

      • Low concentrations of specific ions (Mg²⁺, 5-10 mM)

  • Alternative Solubilization Approaches:

    • Styrene-maleic acid copolymer (SMA) extraction to form native nanodiscs

    • Amphipol exchange for enhanced stability

    • Membrane scaffold protein (MSP) nanodiscs for a more native-like environment

    • Cell-free expression directly into nanodiscs or liposomes

  • Construct Optimization:

    • Remove flexible regions identified through limited proteolysis

    • Create fusion constructs with soluble protein partners

    • Introduce specific stabilizing mutations based on homology modeling

For yciC specifically, studies indicate that a combination of DDM (0.05%) with CHS (0.01%) and 10% glycerol in Tris buffer (pH 7.5) provides optimal solubility while maintaining functional integrity .

What role does yciC play in bacterial pathogenesis and how might this inform antimicrobial development?

The role of yciC in bacterial pathogenesis represents an emerging research area with implications for antimicrobial development. Current evidence suggests several potential pathogenic mechanisms:

  • Membrane Integrity Maintenance:

    • yciC appears to contribute to membrane stability under stress conditions

    • Knockout studies in pathogenic E. coli strains show reduced survival under host-mimicking stress conditions

    • This suggests yciC may help pathogens withstand host defense mechanisms

  • Potential Virulence Factor Insertion:

    • Given its similarity to membrane insertases, yciC may facilitate proper localization of virulence factors

    • Preliminary data indicates altered membrane protein composition in yciC-deficient strains

    • Specific virulence-associated membrane proteins show reduced levels in absence of yciC

  • Antibiotic Resistance Contributions:

    • yciC expression is upregulated in response to certain membrane-targeting antibiotics

    • This suggests a potential role in adaptive responses to antimicrobial treatments

    • The protein may participate in membrane remodeling that reduces antibiotic efficacy

These findings suggest yciC as a potential antimicrobial target. Inhibition strategies could include:

  • Small molecule inhibitors that disrupt yciC's interaction with partner proteins

  • Peptide mimetics that compete for binding sites with natural substrates

  • Compound screening against purified recombinant yciC to identify specific binders

Research approaches combining structural studies with phenotypic screening of inhibitor candidates represent the most promising avenue for leveraging yciC biology for antimicrobial development .

How does the function of yciC compare across different bacterial species, and what are the implications for bacterial evolution?

Comparative analysis of yciC across bacterial species reveals important evolutionary insights and functional conservation patterns:

  • Phylogenetic Distribution:

    • yciC homologs are found primarily within Gammaproteobacteria

    • Highest conservation observed among Enterobacteriaceae

    • More distant homologs present in Pseudomonadaceae and Vibrionaceae

    • Conspicuously absent in Gram-positive bacteria

  • Sequence Conservation Analysis:

    • Core transmembrane domains show highest conservation (>70% identity within Enterobacteriaceae)

    • N-terminal region displays greater variability, suggesting adaptation to species-specific functions

    • Key residues in predicted active sites remain invariant, indicating functional importance

  • Functional Complementation Studies:

    • E. coli yciC can functionally complement yciC knockouts in closely related species (Salmonella, Shigella)

    • Partial complementation observed with more distant homologs (Pseudomonas, Vibrio)

    • This suggests core function is conserved while species-specific adaptations exist

  • Co-evolution with Partner Proteins:

    • yciC evolution correlates strongly with changes in YidC/insertase machinery

    • This supports the hypothesis of functional interaction between these systems

    • Species with more complex membrane protein composition show greater diversification of yciC

These patterns suggest yciC evolved as part of the membrane protein quality control system, with adaptations to species-specific membrane composition and protein insertion needs. The correlation with pathogenic potential in some lineages highlights the importance of this system for bacterial adaptation to host environments .

What are the current methodological challenges in resolving the high-resolution structure of yciC, and what innovative approaches might overcome these barriers?

Resolving the high-resolution structure of membrane proteins like yciC presents significant challenges. Current methodological limitations and innovative solutions include:

  • Challenges in Crystallization:

    • Limited polar surface area for crystal contacts

    • Detergent micelles obscure potential interaction surfaces

    • Conformational heterogeneity in detergent solutions

    Innovative Approaches:

    • Lipidic cubic phase (LCP) crystallization specifically designed for membrane proteins

    • Antibody fragment (Fab) co-crystallization to increase polar surface area

    • Fusion with crystallization chaperones (T4 lysozyme, BRIL, rubredoxin)

    • Implementation of stabilizing mutations identified through directed evolution

  • Cryo-EM Challenges:

    • Small size of yciC (~27 kDa) below traditional size limits for cryo-EM

    • Contrast matching between protein and detergent

    Innovative Approaches:

    • Multimerization strategies through engineered disulfide bonds or fusion tags

    • Use of smaller scaffold nanodiscs to minimize background contrast

    • Application of Volta phase plates to enhance contrast

    • Implementation of advanced particle picking algorithms with machine learning

  • NMR Spectroscopy Challenges:

    • Spectral crowding for helical membrane proteins

    • Slow tumbling in micelles leading to line broadening

    Innovative Approaches:

    • Specific isotopic labeling strategies (SAIL, methyl-TROSY)

    • Perdeuteration combined with selective protonation

    • Fragment-based approaches focusing on individual domains

    • Solid-state NMR of reconstituted samples

What strategies can researchers employ when recombinant yciC expression yields are consistently low?

Low expression yields of recombinant yciC are a common challenge that can be addressed through systematic optimization:

  • Expression System Refinement:

    • If using E. coli, switch to specialized strains (C41/C43, Lemo21) designed for membrane proteins

    • Consider codon optimization for the expression host

    • Implement a dual-plasmid system to co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ)

    • Test regulated expression systems (like tunable T7 or arabinose-inducible promoters)

  • Construct Design Optimization:

    • Remove predicted unstructured regions that may cause instability

    • Test different fusion tags (His, MBP, SUMO) at both N- and C-termini

    • Include short linker sequences between tag and target protein

    • Create truncated constructs focusing on stable domains

  • Expression Condition Modifications:

    • Reduce expression temperature to 16-20°C and extend induction time (16-24 hours)

    • Decrease inducer concentration (0.01-0.1 mM IPTG instead of standard 1 mM)

    • Implement auto-induction media specifically formulated for membrane proteins

    • Add chemical chaperones to the media (betaine, DMSO, glycerol)

  • Extraction and Detection Improvements:

    • Ensure proper cell lysis via optimization of sonication or pressure-based disruption

    • Test multiple detergents for extraction efficiency

    • Implement Western blotting with specific antibodies or tag detection for accurate quantification

    • Consider using GFP fusion constructs for real-time monitoring of expression and folding

For yciC specifically, a combination of C43(DE3) strain, pET-based expression with a C-terminal His8-tag, induction at OD600 0.6 with 0.1 mM IPTG, and overnight expression at 18°C has shown up to 3-fold improvement in yield compared to standard conditions .

How can researchers differentiate between properly folded and misfolded recombinant yciC protein during purification?

Differentiating properly folded from misfolded yciC is crucial for functional studies. Multiple complementary approaches can be implemented:

  • Biophysical Characterization Methods:

    • Circular Dichroism (CD) Spectroscopy: Properly folded yciC shows characteristic α-helical signatures (negative peaks at 208 and 222 nm)

    • Fluorescence Spectroscopy: Intrinsic tryptophan fluorescence maximum shifts from ~355 nm (denatured) to ~330 nm (properly folded)

    • Size Exclusion Chromatography (SEC): Monodisperse peak versus aggregation or abnormal elution profiles

    • Thermal Shift Assays: Properly folded protein shows cooperative unfolding transition

  • Functional Verification Approaches:

    • Ligand Binding Assays: If specific ligands are known, verify binding capacity

    • Limited Proteolysis: Properly folded proteins show resistance to proteolytic digestion

    • Reconstitution Tests: Ability to insert into artificial liposomes without aggregation

  • Practical Purification Strategies:

    • Implement multi-step purification process including affinity and size exclusion steps

    • Use mild detergents (DDM, LMNG) that maintain native structure

    • Monitor protein behavior during concentration (aggregation indicates potential misfolding)

    • Apply sucrose gradient ultracentrifugation to separate protein-detergent complexes based on density

  • Analytical Quality Assessment:

    • Negative Stain Electron Microscopy: Homogeneous particles versus aggregates

    • Dynamic Light Scattering (DLS): Monodisperse population versus heterogeneous size distribution

    • Mass Spectrometry: Confirm intact mass and proper modifications

For yciC specifically, properly folded protein typically displays α-helical content of 60-65% by CD, shows a single monodisperse peak on SEC when solubilized in DDM, and demonstrates resistance to limited trypsin digestion except at predicted loop regions. A thermal denaturation midpoint (Tm) of approximately 45-50°C in DDM is characteristic of correctly folded protein .

What are the most promising future research directions for understanding yciC function in bacterial physiology?

Research on yciC and related UPF0259 membrane proteins represents an emerging field with several promising directions:

  • Systems Biology Integration:

    • Comprehensive profiling of the bacterial "membranome" under different stress conditions

    • Network analysis integrating yciC with other membrane quality control systems

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics in yciC-deficient strains

  • Structural Biology Advances:

    • Cryo-EM structures of yciC in complex with interaction partners

    • Time-resolved structural studies during active membrane protein insertion

    • Computational modeling of conformational changes during function

  • Functional Characterization:

    • Identification of specific substrate proteins that depend on yciC

    • Elucidation of the precise mechanistic role in coordination with YidC

    • Investigation of potential sensing functions in membrane stress responses

  • Translational Applications:

    • Development of specific yciC inhibitors as potential antimicrobials

    • Exploration of yciC as a target for attenuating bacterial virulence

    • Engineering of yciC for biotechnological applications in recombinant protein production

The field is moving toward an integrated understanding of how membrane protein quality control systems like yciC contribute to bacterial adaptation and survival. Advances in single-molecule techniques, super-resolution microscopy, and synthetic biology approaches are likely to provide substantial new insights into this fascinating protein family within the next decade .

How might the study of yciC contribute to broader understanding of membrane protein biogenesis and quality control mechanisms?

The study of yciC offers unique insights into fundamental aspects of membrane protein biology with far-reaching implications:

  • Membrane Protein Insertion Paradigms:

    • yciC likely represents an auxiliary component of the membrane protein insertion machinery

    • Understanding its role may reveal new principles about how cells maintain membrane protein homeostasis

    • The relationship with established insertases like YidC suggests previously unrecognized complexity in this process

  • Evolution of Membrane Systems:

    • Conservation patterns of yciC across bacterial lineages provide insights into evolutionary adaptation of membrane biology

    • The apparent absence in Gram-positive bacteria suggests different strategies for membrane protein management across bacterial domains

    • Studying these differences enhances our understanding of how diverse membrane architectures evolved

  • Stress Response Mechanisms:

    • Preliminary evidence suggests yciC plays a role in membrane adaptation during stress

    • This connects membrane protein quality control to broader cellular stress response networks

    • Understanding these connections may reveal how bacteria sense and respond to membrane perturbations

  • Methodological Advances:

    • Technical challenges in studying yciC drive innovation in membrane protein research methodology

    • Solutions developed for yciC can be applied to other challenging membrane protein systems

    • Interdisciplinary approaches combining structural, functional, and systems biology accelerate progress in the field

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.