Recombinant UPF0266 membrane protein yobD (yobD)

Shipped with Ice Packs
In Stock

Description

General Information

UPF0266 membrane protein YobD is a putative membrane protein of unknown function found in bacteria . This protein is present in Shigella flexneri and Escherichia coli O9:H4 . The HAMAP entry MF_01071 classifies YobD as part of a protein family with unknown functions .

Relevance to Drug Discovery

Understanding bacterial membrane proteins is significant in drug discovery, particularly for developing new antibacterial agents. For example, inhibiting deubiquitinating enzymes like USP1 in association with UAF1 has shown promise as an anticancer target . Although YobD itself isn't directly linked to these processes, the general approach of targeting bacterial proteins for therapeutic intervention is relevant.

Tables and Figures

Since there is no specific data available for "Recombinant UPF0266 membrane protein yobD (yobD)", the following tables and figures illustrate related concepts and findings from the cited articles.

Table 1: Effects of Compounds on Ub-PCNA Levels and Cell Survival

Compound$$IC_{50}$$ for USP1/UAF1 InhibitionFold Change in Ub-PCNAColony Formation Reduction$$R^2$$ Value
48Data not availableSignificant Increase>70%0.98
49Data not availableSignificant Increase>70%0.93
64Data not availableSignificant Increase>70%0.91
69Data not availableSignificant Increase>70%
70Data not availableSignificant Increase>70%
1Data not availableMinimal EffectMinimal Effect
77Data not availableNo EffectNo Effect

This table illustrates the correlation between USP1/UAF1 inhibition, Ub-PCNA levels, and cell survival, demonstrating the potential of targeting deubiquitinating enzymes in cancer therapy .

Figure 1: BAM Complex Interaction with OmpC(Y286A)
This figure would illustrate the interaction of OmpC(Y286A) with the BAM complex, showing the stalled intermediate and the involvement of BamA and BamD. It would highlight the regions of BamA and BamD that interact with the OMP substrate, based on data from biophysical assays such as Neutral Reflection (NR) .

Figure 2: Molecular Docking Analysis of Antitubercular Agents
A visual representation of synthesized pyrrole scaffolds docked with enoyl ACP reductase and dihydrofolate reductase could demonstrate the binding interactions at the active sites, illustrating the mechanism of action of dual inhibitors .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, add 5-50% glycerol (final concentration) and aliquot at -20°C/-80°C. Our standard glycerol concentration is 50% and may be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
yobD; SF1408; S1523; UPF0266 membrane protein YobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Shigella flexneri
Target Names
yobD
Target Protein Sequence
MTITDLVLILFIAALLAFAIYDQFIMPRRNGPTLLAIPLLRRGRIDSVIFVGLIVILIYN NVTNHGALITTWLLSALALMGFYIFWIRIPKIIFKQKGFFFANVWIEYSRIKAMNLSEDG VLVMQLEQRRLLIRVRNIDDLEKIYKLLVSGNAANLLI
Uniprot No.

Target Background

Database Links

KEGG: sfl:SF1408

Protein Families
UPF0266 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal expression systems for recombinant UPF0266 membrane protein yobD?

E. coli and yeast expression systems typically provide the highest yields and shortest turnaround times for recombinant UPF0266 membrane protein yobD production. These prokaryotic and lower eukaryotic systems offer cost-effective and rapid production capabilities suitable for initial characterization studies and when post-translational modifications are not critical to the research question . For studies requiring proper protein folding or functional activity that depends on post-translational modifications, insect cells with baculovirus expression systems or mammalian cell expression systems are recommended despite their lower yields and longer production times . These advanced eukaryotic systems can provide many of the post-translational modifications necessary for preserving the native structure and function of the membrane protein.

When choosing an expression system, researchers should consider the following methodological approach:

  • Begin with E. coli expression for initial production and structural studies

  • Progress to yeast systems if higher yields of properly folded protein are needed

  • Utilize insect or mammalian cells when studying functional aspects that may depend on specific post-translational modifications

What purification challenges are specific to UPF0266 membrane protein and how can they be addressed?

As a membrane protein, UPF0266 yobD presents typical challenges associated with hydrophobic transmembrane domains. Successful purification requires careful selection of detergents to solubilize the protein while maintaining its native conformation. Researchers should implement a methodological approach that begins with membrane isolation followed by selective solubilization using detergents like dodecyl maltoside (DDM) or digitonin that preserve protein structure. After solubilization, affinity chromatography utilizing tags engineered into the recombinant construct provides effective initial purification. Subsequent size exclusion chromatography helps remove aggregates and achieve higher purity.

The hydrophobic nature of membrane proteins like yobD often results in protein aggregation during concentration steps. To mitigate this, researchers should maintain the critical micelle concentration (CMC) of the chosen detergent throughout the purification process and consider using amphipols or nanodiscs for stabilization during downstream applications .

How can researchers determine the membrane topology of UPF0266 membrane protein yobD?

Determining the membrane topology of UPF0266 membrane protein yobD requires a combination of computational prediction and experimental validation. Computational analysis using hydropathy plots identifies potential transmembrane segments as stretches of 20-30 amino acids with high hydrophobicity . These plots can predict the number of membrane-spanning regions and their orientation.

For experimental validation, researchers should employ vectorial labeling techniques, where membrane-impermeant reagents like radioactive or fluorescent markers are used to label exposed portions of the protein. By comparing labeling patterns from both sides of the membrane (using sealed vesicles or inside-out vesicles), researchers can map which domains are exposed to which side of the membrane . Complementary approaches include:

  • Proteolytic digestion from either side of the membrane to identify exposed domains

  • Site-directed antibody binding to specific epitopes

  • Cysteine-scanning mutagenesis with membrane-impermeant sulfhydryl reagents

These methods, when used in combination, provide robust evidence for the transmembrane orientation of yobD. The experimental approach should begin with computational prediction to generate a topological model, followed by strategic experimental validation of key regions using the methods described above .

What advanced biophysical techniques can be applied to study UPF0266 membrane protein structure?

For detailed structural analysis of UPF0266 membrane protein yobD, researchers can employ multiple complementary biophysical techniques. X-ray crystallography provides atomic-level resolution but requires successful crystallization of the protein, which is challenging for membrane proteins due to their amphipathic nature. Electron crystallography, as used for bacteriorhodopsin, offers an alternative approach when two-dimensional crystals can be formed in the membrane . This technique has successfully determined structures of transmembrane proteins with multiple α-helices similar to what might be expected for yobD.

For solution-state analysis, researchers can use:

What methodologies can identify potential functions of the uncharacterized UPF0266 membrane protein?

Identifying the function of UPF0266 membrane protein yobD requires a multi-faceted approach combining computational predictions with experimental validation. Begin with bioinformatic analysis by identifying conserved domains, sequence homology with characterized proteins, and genomic context analysis (examining neighboring genes that may be functionally related). Structural predictions can suggest potential binding sites or functional motifs.

Experimentally, gene knockout or knockdown studies can reveal phenotypic changes indicating the protein's role. For membrane proteins like yobD, these changes might include alterations in membrane permeability, transport capabilities, or signal transduction. Site-directed mutagenesis of predicted functional residues followed by phenotypic analysis can validate computational predictions.

Protein-protein interaction studies using techniques like bacterial two-hybrid systems, co-immunoprecipitation adapted for membrane proteins, or proximity labeling methods can identify interaction partners that may suggest functional pathways. Additionally, researchers should consider:

  • Reconstitution in liposomes to test transport or channel activity

  • Substrate binding assays to identify potential ligands

  • Localization studies to determine subcellular distribution patterns

  • Expression profile analysis under various growth conditions

This systematic approach allows researchers to gradually build evidence for specific functions, moving from computational predictions to experimental validation .

How can researchers study UPF0266 membrane protein dynamics in the membrane?

Studying the dynamics of UPF0266 membrane protein yobD requires techniques that can monitor protein movement within the membrane environment. Fluorescence recovery after photobleaching (FRAP) is particularly suitable for this purpose. In this approach, researchers express yobD fused to GFP and then bleach the fluorescence in a small membrane area using a laser beam. The rate at which fluorescence recovers in the bleached area indicates how rapidly the protein diffuses within the membrane plane .

A complementary technique is fluorescence loss in photobleaching (FLIP), where continuous bleaching in one area depletes fluorescently labeled molecules throughout the membrane. The rate of depletion in distant areas provides information about the mobility and potential restrictions on protein movement . These techniques allow researchers to calculate diffusion coefficients and determine if yobD forms complexes or interacts with membrane microdomains.

For more detailed study of conformational dynamics, researchers can employ:

  • Single-molecule tracking using quantum dots or specialized fluorophores

  • Förster resonance energy transfer (FRET) between labeled domains to detect conformational changes

  • Hydrogen-deuterium exchange mass spectrometry adapted for membrane proteins

  • Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling

These methods provide complementary information about how yobD moves within the membrane and whether it undergoes conformational changes during function .

How can Design of Experiments (DoE) be applied to optimize UPF0266 membrane protein expression?

Design of Experiments (DoE) provides a systematic approach to optimizing multiple factors affecting UPF0266 membrane protein yobD expression simultaneously. Unlike one-factor-at-a-time approaches, DoE reveals interaction effects between variables and identifies optimal conditions more efficiently. For yobD expression, researchers should first identify key factors including temperature, induction timing, inducer concentration, media composition, and host strain selection.

A typical DoE approach for membrane protein expression optimization follows these steps:

  • Screening design (e.g., fractional factorial) to identify significant factors from many potential variables

  • Response surface methodology to map the relationship between significant factors and expression yield

  • Optimization algorithms to identify optimal conditions for maximum protein yield and quality

For membrane proteins like yobD, additional factors to consider include membrane-targeting signal sequences, fusion partners that enhance membrane insertion, and specialized growth conditions that affect membrane composition. When implementing DoE for yobD expression, include metrics beyond protein yield, such as proper folding, membrane integration, and functional activity .

The optimal expression conditions will likely differ depending on the expression host. While E. coli and yeast offer higher yields and faster expression, insect and mammalian systems provide better post-translational modifications . A comprehensive DoE approach should account for these host-specific differences when designing experiments.

What analytical methods effectively monitor UPF0266 membrane protein quality during expression optimization?

Effective optimization of UPF0266 membrane protein yobD expression requires robust analytical methods to monitor both quantity and quality. Western blotting with antibodies against affinity tags or the protein itself provides quantitative assessment of expression levels. For quality assessment, researchers should implement a multi-method approach that evaluates:

  • Membrane integration: Fractionation studies comparing membrane versus cytosolic fractions

  • Protein folding: Limited proteolysis to detect properly folded structures resistant to digestion

  • Oligomeric state: Blue native PAGE or size exclusion chromatography

  • Functional activity: Assays specific to predicted functions (e.g., binding, transport)

Fluorescence-based methods can monitor yobD folding and membrane integration in real-time. For example, a GFP fusion that fluoresces only when properly folded can indicate correct processing. Circular dichroism spectroscopy provides information about secondary structure content, which correlates with proper folding.

For high-throughput screening during DoE studies, researchers should develop rapid analytical methods such as in-gel fluorescence or dot-blot assays that can process multiple samples quickly. Mass spectrometry can verify protein identity and detect post-translational modifications, particularly important when using eukaryotic expression systems that provide these modifications .

How can researchers determine if UPF0266 membrane protein adopts single-pass or multi-pass transmembrane configurations?

Determining whether UPF0266 membrane protein yobD forms single-pass or multi-pass transmembrane structures requires a combination of computational prediction and experimental validation. Computational analysis using hydropathy plots identifies segments of 20-30 amino acids with high hydrophobicity that potentially span the membrane . The number of these segments provides initial prediction of the transmembrane topology.

For experimental validation, researchers should employ:

  • Cysteine accessibility scanning: Systematically replace residues with cysteine and test their accessibility to membrane-impermeant sulfhydryl reagents from both sides of the membrane

  • Epitope insertion followed by antibody binding assays: Insert epitope tags at predicted loops and termini, then test antibody accessibility from both sides

  • Glycosylation mapping: Insert glycosylation sites at various positions and determine which become glycosylated (indicating luminal/extracellular exposure)

  • Protease protection assays: Compare proteolytic fragmentation patterns from both membrane sides

The gold standard for definitive topology determination combines these approaches with structural studies. For membrane proteins with multiple transmembrane segments like bacteriorhodopsin, electron crystallography or X-ray crystallography can reveal the precise arrangement of transmembrane helices . Researchers should progressively build evidence from multiple complementary methods to establish a robust topological model.

What techniques can determine if UPF0266 membrane protein forms α-helical or β-barrel structures?

To distinguish between these structural motifs, researchers should implement:

  • Circular dichroism (CD) spectroscopy: α-helices and β-sheets display distinctive CD spectra, allowing quantification of secondary structure composition

  • Fourier-transform infrared (FTIR) spectroscopy: Provides secondary structure information in membrane environments

  • Oriented CD spectroscopy: Determines the orientation of α-helices relative to the membrane plane

  • Hydrogen-deuterium exchange mass spectrometry: Identifies protected regions consistent with secondary structure elements

Computational prediction algorithms can supplement experimental data by analyzing sequence patterns characteristic of transmembrane α-helices versus β-barrels. For α-helical proteins, hydrophobic residues typically occur every 3-4 positions (one face of the helix), while β-barrel proteins show alternating hydrophobic residues .

For definitive structural determination, researchers must pursue high-resolution techniques like X-ray crystallography, electron crystallography, or cryo-electron microscopy. These approaches have successfully revealed how transmembrane proteins like bacteriorhodopsin organize multiple α-helices into functional structures .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.