Recombinant UPF0266 membrane protein YPO1755/y2554/YP_1637 (YPO1755, y2554, YP_1637)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant UPF0266 membrane protein YPO1755/y2554/YP_1637 (UniProt ID: Q8ZFF7) is a 153-amino acid polypeptide expressed in heterologous systems such as E. coli, yeast, baculovirus, or mammalian cells . It belongs to the UPF0266 protein family, which includes uncharacterized membrane proteins conserved in Gram-negative bacteria.

AttributeDetail
Gene LocusYPO1755, y2554, YP_1637 (synonyms)
Source OrganismYersinia pestis (plague-causing bacterium)
Molecular Weight~18 kDa (theoretical)
TagHis-tag (N-terminal) or untagged, depending on production method
Purity>90% (verified by SDS-PAGE)

Production Methods

The protein is commercially produced in multiple expression systems, each offering distinct advantages:

Host SystemYieldPost-Translational ModificationsTurnaround Time
E. coliHighLimited2–3 weeks
YeastModerateBasic glycosylation3–4 weeks
Baculovirus (Insect)Low-ModerateComplex modifications (e.g., phosphorylation)6–8 weeks
Mammalian CellsLowHuman-like modifications8–10 weeks

E. coli remains the most cost-effective option for bulk production, while mammalian systems are preferred for functional studies requiring native-like folding .

Research Applications

This recombinant protein is primarily used in:

  1. ELISA Development: Detecting anti-Yersinia antibodies in serum samples .

  2. Structural Biology: Studying membrane protein folding via X-ray crystallography .

  3. Pathogenicity Studies: Investigating Y. pestis host-cell interactions.

Quality Control Data

Critical benchmarks from recent batches:

ParameterSpecification
Endotoxin Levels<1.0 EU/µg (Limulus Amebocyte Lysate test)
Aggregation Analysis<5% by dynamic light scattering
Functional ActivityConfirmed via ligand-binding assays

Supplier Landscape

Major vendors include Creative BioMart ($1,496/50 µg) , American Scientific, and Lifeome. Pricing varies by expression system, with mammalian-cell-derived versions costing 3–5× more than E. coli-produced equivalents .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your desired tag type for preferential development.
Synonyms
YPO1755; y2554; YP_1637; UPF0266 membrane protein YPO1755/y2554/YP_1637
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Yersinia pestis
Target Names
YPO1755
Target Protein Sequence
MSVTDLVLVVFIALLLIYAIYDEFIMNMMKGKTRLQVHLKRKNKLDCMIFVGLIGILIYN NVMAHGAPLTTYLLVGLALVAVYISYIRWPKLLFKNTGFFYANTFIEYSRIKSMNLSEDG ILVIDLEQRRLLIQVKKLDDLEKIYNFFIENQS
Uniprot No.

Target Background

Database Links

KEGG: ype:YPO1755

STRING: 187410.y2554

Protein Families
UPF0266 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.