Recombinant UPF0283 membrane protein VV1_2269 (VV1_2269)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

VV1_2269 is recombinantly produced in two systems:

ParameterE. coli Expression Cell-Free Expression
HostEscherichia coliCell-free system
TagN-terminal HisUndetermined (varies by production)
Purity>90% (SDS-PAGE verified)≥85%
StorageLyophilized in Tris/PBS + 6% trehaloseLiquid with glycerol preservative
ReconstitutionRequires deionized water + glycerolPre-solubilized

Detergent screening (e.g., DDM/CHS) or Nanodisc technology may be employed to stabilize hydrophobic regions during purification .

Research Applications

VV1_2269 is utilized in:

  1. Antibody development: Displayed on virus-like particles (VLPs) for antigen presentation .

  2. Structural studies: Compatibility with detergent-free Nanodiscs enables cryo-EM or mass photometry analysis .

  3. Interaction mapping: Yeast two-hybrid and pull-down assays identify binding partners .

Challenges in Membrane Protein Expression

VV1_2269 production faces common hurdles for transmembrane proteins:

  • Host stress: E. coli may misfield hydrophobic domains, necessitating codon optimization or low-temperature induction .

  • Detergent compatibility: Aggregation risks require empirical screening of solubilization agents (e.g., LDAO, DDM) .

Future Directions

Critical gaps include:

  • Functional annotation: No confirmed enzymatic or receptor activity reported .

  • Structural data: No PDB entries exist as of March 2025 .

Advanced techniques like automated mass photometry or BacMam-mediated mammalian expression could address these limitations .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
VV1_2269; UPF0283 membrane protein VV1_2269
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-341
Protein Length
full length protein
Species
Vibrio vulnificus (strain CMCP6)
Target Names
VV1_2269
Target Protein Sequence
MSDLKPKQVFEETIFSQQDKPELTAQQQFDQQQTFIPTTIEETEPELEDALEQVIRPSGR RKWLAGGLFAAFAGLVGWQAVDSVLSAMQNGDWLTLGWSGFISVLAGLGLGAMGKELWKL RQLRHLFSVQEQGEKLLQSDSVGQGKAFCQQVAKQSGVAEENPAYDRWKNSVNTAHSDAE ILQMYDAMVVTQQDKQATKVISRFATESAALVAISPLAIADMLLVAWRNFKMIDTLSTIY GIELGYASRIRLLRLVLANMAVAGASELVIDAGMDLMSMDLAGKLSARAGQGVGVGILTA RLGLKAMALLRPIPWQAETQVKLSAIRKEIVSKVASITLKP
Uniprot No.

Target Background

Database Links

KEGG: vvu:VV1_2269

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How should recombinant UPF0283 membrane protein VV1_2269 be stored to maintain its stability?

Maintaining the stability of recombinant UPF0283 membrane protein VV1_2269 requires specific storage conditions. The lyophilized protein should be stored at -20°C or preferably at -80°C for extended storage periods . After reconstitution, it is recommended to add glycerol to a final concentration of 50% to prevent freeze-thaw damage. For working aliquots that will be used within one week, storage at 4°C is sufficient .

Repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation and aggregation. The recommended storage buffer is Tris/PBS-based with 6% trehalose at pH 8.0, which helps maintain the native conformation of the protein . If frequent use is anticipated, dividing the reconstituted protein into single-use aliquots is strongly recommended to minimize exposure to damaging freeze-thaw cycles.

What expression systems are suitable for producing recombinant UPF0283 membrane protein VV1_2269?

Based on current research protocols, E. coli is the preferred expression system for recombinant UPF0283 membrane protein VV1_2269 . The protein can be successfully expressed with an N-terminal His-tag, facilitating downstream purification via metal affinity chromatography. The tag does not appear to interfere with the protein's structural integrity.

For optimal expression, several factors should be considered:

ParameterRecommended ConditionRationale
E. coli strainBL21(DE3) or derivativesLacks proteases that could degrade the target protein
Induction temperature18-25°CLower temperatures reduce formation of inclusion bodies
IPTG concentration0.1-0.5 mMLower concentrations promote proper folding
Expression time12-16 hoursExtended time allows for accumulation of properly folded protein

Alternative expression systems such as mammalian or insect cells may be considered if E. coli expression yields insufficient quantities of functional protein, though these approaches would require significant protocol adjustments .

What reconstitution methods are recommended for lyophilized UPF0283 membrane protein preparations?

Reconstitution of lyophilized UPF0283 membrane protein VV1_2269 should begin with brief centrifugation of the vial to collect the protein at the bottom . The protein should be reconstituted in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL . Gentle mixing is crucial to avoid protein denaturation - avoid vortexing and instead use slow rotation or gentle pipetting.

After initial reconstitution, adding glycerol to a final concentration of 50% is recommended to enhance stability for long-term storage . For researchers aiming to incorporate the protein into artificial membrane systems or liposomes, additional steps are necessary:

  • Prepare lipid vesicles (e.g., DOPC/DOPE/cholesterol at 7:2:1 molar ratio)

  • Mix the reconstituted protein with detergent-solubilized lipids

  • Remove detergent via dialysis or adsorption using Bio-Beads

  • Confirm successful incorporation using techniques such as dynamic light scattering

These methods maintain the protein in a membrane-like environment, which is crucial for preserving its native structure and function.

What are the challenges in structural characterization of UPF0283 membrane protein VV1_2269, and how can they be addressed?

Structural characterization of UPF0283 membrane protein VV1_2269 faces significant challenges due to its hydrophobic nature and multiple transmembrane domains. Traditional approaches like X-ray crystallography are hampered by difficulties in obtaining well-diffracting crystals of membrane proteins.

Recent advances in protein solubilization technologies offer promising alternatives. The WRAP (Water-soluble RFdiffused Amphipathic Proteins) approach described in the literature provides a method to solubilize membrane proteins while preserving their structure and function . This approach involves:

  • Generating idealized de novo helical and beta-barrel backbones that match the dimensions of the target protein

  • Refining these backbones to complement the shape and side chain interactions of the target using partial diffusion

  • Designing amino acid sequences for the WRAP domains using specialized algorithms like SolubleMPNN

  • Selecting promising designs based on AlphaFold2 structure prediction metrics (pLDDT > 85; PAE_i < 8; RMSD to design < 1 Å)

This WRAP technology has successfully solubilized various membrane proteins while maintaining their functionality, including GlpG rhomboid protease with enhanced thermostability compared to detergent-solubilized versions . Applying this approach to UPF0283 membrane protein VV1_2269 could facilitate its structural characterization through cryo-EM or potentially X-ray crystallography.

Alternative approaches include the use of antibody-based fragments to stabilize the protein structure or the application of lipid nanodiscs to maintain a native-like membrane environment .

How can researchers assess the functionality of recombinant UPF0283 membrane protein VV1_2269 after purification?

Assessing the functionality of recombinant UPF0283 membrane protein VV1_2269 after purification presents a significant challenge due to its uncharacterized function. Several complementary approaches can be employed:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure retention and thermal stability

    • Size exclusion chromatography (SEC) to verify that the protein exists in the expected oligomeric state

    • Limited proteolysis to assess proper folding (properly folded membrane proteins typically show resistance to proteolysis in their transmembrane regions)

  • Functional assays:

    • Binding studies with potential ligands using techniques such as isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR)

    • Reconstitution into proteoliposomes followed by transport or activity assays

    • If homology with functionally characterized proteins exists, adapting established functional assays

  • Interaction partners identification:

    • Pull-down assays using the His-tagged protein to identify potential binding partners

    • Antibody-based microarrays for detecting potential protein-protein interactions on the cell surface

    • Crosslinking studies followed by mass spectrometry to identify proximal proteins

The recent success with activity assays for WRAPed GlpG using fluorophosphonate serine hydrolase probes demonstrates that membrane proteins can retain their functionality even after solubilization with WRAP technology . Similar probe-based approaches could be developed for UPF0283 membrane protein VV1_2269 once its function is better understood.

What optimization strategies can improve the yield and purity of recombinant UPF0283 membrane protein VV1_2269?

Optimizing the yield and purity of recombinant UPF0283 membrane protein VV1_2269 requires a multi-faceted approach addressing expression, extraction, and purification:

Expression optimization:

ParameterOptimization StrategyExpected Impact
Codon optimizationAdapt codons to E. coli preferenceIncreases translation efficiency
Fusion partnersTest SUMO, MBP, or thioredoxin fusionsImproves solubility and folding
Cell density at inductionInduce at OD600 = 0.6-0.8Balances growth and expression
Media compositionSupplement with trace elements and glucoseProvides resources for protein synthesis
Induction durationTest 16-24 hour expressionIdentifies optimal accumulation window

Extraction and purification optimization:

  • Detergent screening is crucial for effective extraction - start with a panel including DDM, LMNG, LDAO, and FC-12

  • Implement a two-step purification strategy:

    • Initial IMAC (immobilized metal affinity chromatography) using the His-tag

    • Secondary purification using size exclusion chromatography (SEC)

  • Add stabilizing agents throughout purification:

    • Specific lipids (e.g., cholesterol or phosphatidylglycerol)

    • Glycerol (10-20%)

    • Appropriate salt concentration (typically 150-300 mM NaCl)

Alternatively, the WRAP technology described in recent literature offers a promising approach for obtaining soluble, functional membrane proteins without detergents . This method involves designing custom protein domains that wrap around the hydrophobic regions of the membrane protein, rendering it water-soluble while preserving its structure and function.

What are the potential approaches for designing antibody-based detection systems for UPF0283 membrane protein VV1_2269?

Designing antibody-based detection systems for UPF0283 membrane protein VV1_2269 can leverage recent advances in recombinant antibody technology and microarray platforms. Key approaches include:

  • Recombinant antibody fragment generation:

    • Single-chain variable fragments (scFvs) can be developed through phage display technology

    • The smaller size of scFvs compared to conventional antibodies makes them advantageous for accessing epitopes in membrane proteins

    • Immunization strategies should consider using WRAP-stabilized UPF0283 to preserve native conformation

  • Microarray development:

    • Recombinant antibody microarrays can enable multiplexed detection of UPF0283 along with other membrane proteins

    • This approach allows for rapid and sensitive profiling of the membrane proteome in intact cells

    • The microarray can be designed to target both protein epitopes and potential post-translational modifications

  • Detection optimization:

    • Direct labeling of cells using fluorescent dyes or indirect detection using secondary reagents

    • Digital holography can be paired with antibody microarrays for label-free detection

    • Sandwich assay formats may increase specificity and sensitivity

The literature indicates that recombinant antibody microarrays have successfully been applied to cell surface membrane proteomics, allowing for specific and sensitive multiplexed profiling . These platforms can detect differential expression patterns in response to external stimuli, which may be valuable for understanding the functional role of UPF0283 membrane protein VV1_2269.

How can researchers apply the WRAP technology to solubilize UPF0283 membrane protein VV1_2269 for structural studies?

Applying WRAP technology to solubilize UPF0283 membrane protein VV1_2269 for structural studies would involve a systematic implementation of the deep learning-based design approach described in recent literature . This methodology encompasses several key steps:

  • Preparation of the target protein structure:

    • Generate a predicted structure of UPF0283 using AlphaFold2 or RoseTTAFold if experimental structures are unavailable

    • Identify the membrane-spanning regions that require solubilization

  • Design of complementary WRAP domains:

    • Generate idealized de novo helical or beta-barrel backbones that match the dimensions of UPF0283

    • For UPF0283, which likely has multiple transmembrane helices, cylindrical antiparallel helical assemblies would be appropriate

    • The inner diameter of these assemblies should be compatible with the membrane-spanning region of UPF0283

  • Refinement and optimization:

    • Use partial diffusion techniques to mold the de novo backbones to the UPF0283 structure

    • Apply specialized algorithms like SolubleMPNN to design sequences for the WRAP domains

    • Select promising designs using AlphaFold2 structure prediction metrics (pLDDT > 85; PAE_i < 8)

  • Experimental validation:

    • Express and purify the designed WRAP-UPF0283 constructs

    • Assess solubility through SEC analysis

    • Evaluate structural integrity using CD spectroscopy and thermal stability assays

    • Perform cryo-EM analysis to confirm the structure matches the computational design

The WRAP approach has successfully solubilized both beta-barrel and helical membrane proteins while preserving their functionality and enhancing thermal stability . Given that UPF0283 is an uncharacterized protein, this approach could not only facilitate structural studies but also provide insights into its function through comparative analysis with structurally similar proteins.

What strategies can address protein aggregation issues during UPF0283 membrane protein expression and purification?

Protein aggregation is a common challenge when working with membrane proteins like UPF0283. Several strategies can help mitigate this issue:

  • Expression condition modifications:

    • Lower the expression temperature to 18°C or even 16°C

    • Reduce IPTG concentration to 0.1 mM or below

    • Supplement growth media with chemical chaperones like glycerol (5-10%) or arginine (50-100 mM)

  • Buffer optimization during purification:

    • Increase the concentration of glycerol to 10-20%

    • Add specific lipids that might stabilize the protein (e.g., cholesterol, E. coli lipid extract)

    • Test different detergents beyond those typically used for solubilization

    • Include stabilizing additives like sucrose or specific amino acids (arginine, glutamate)

  • Protein engineering approaches:

    • Identify and mutate aggregation-prone regions using computational prediction tools

    • Introduce thermostabilizing mutations based on homology modeling

    • Create fusion constructs with highly soluble partners

  • Advanced solubilization strategies:

    • Apply the WRAP technology as described in recent literature to create a water-soluble version of UPF0283

    • Test amphipol-based solubilization as an alternative to traditional detergents

    • Explore nanodiscs or lipid cubic phase systems for maintaining native-like environments

When aggregation is detected during SEC analysis, implementation of a combination of these strategies may be necessary. Systematic testing of different conditions through small-scale expression and purification trials can help identify the optimal approach for UPF0283 membrane protein VV1_2269.

How can researchers distinguish between functional and non-functional forms of recombinant UPF0283 membrane protein?

Distinguishing between functional and non-functional forms of recombinant UPF0283 membrane protein represents a significant challenge, particularly given its uncharacterized nature. Several complementary approaches can help researchers make this distinction:

  • Structural integrity assessments:

    • Compare the CD spectra of the purified protein with theoretical predictions based on sequence analysis

    • Monitor thermal denaturation curves - functional membrane proteins typically exhibit cooperative unfolding

    • Perform limited proteolysis - properly folded proteins show characteristic proteolytic patterns

  • Comparative analysis with known functional forms:

    • Develop multiple purification protocols and compare the resulting protein preparations

    • Analyze oligomeric state using techniques like SEC-MALS (size exclusion chromatography with multi-angle light scattering)

    • Examine detergent/lipid binding profiles using mass spectrometry

  • Activity surrogate markers:

    • Binding studies with potential substrate analogs or inhibitors

    • Conformational change assays using environmentally sensitive probes

    • Reconstitution into liposomes and assessment of membrane integrity

  • Cell-based functional assays:

    • Complement deficient bacterial strains (if homologs with known function exist)

    • Assess the impact of protein expression on cellular phenotypes

    • Monitor localization patterns using fluorescence microscopy

Given that WRAPed membrane proteins have been shown to retain functionality, as demonstrated with GlpG rhomboid protease , applying this solubilization technology to UPF0283 may provide a platform for establishing functional assays. The enhanced stability observed with WRAPed proteins can also facilitate longer and more complex functional characterization experiments.

What analytical methods are most effective for quality control of purified UPF0283 membrane protein preparations?

Quality control of purified UPF0283 membrane protein preparations requires a multi-method approach to assess purity, homogeneity, structural integrity, and stability:

Analytical MethodParameter AssessedAcceptance Criteria
SDS-PAGEPurity>90% purity based on densitometry
Western blotIdentitySingle band at expected molecular weight with anti-His antibody
SECHomogeneitySingle symmetric peak at expected elution volume
Dynamic light scatteringMonodispersityPolydispersity index <0.2
CD spectroscopySecondary structureSpectrum consistent with alpha-helical content prediction
Thermal stabilityStabilityConsistent Tm across batches
Mass spectrometryIntact massMass within 0.1% of theoretical value

For membrane proteins specifically, additional quality control measures include:

  • Detergent content analysis:

    • Quantify bound detergent using colorimetric assays or mass spectrometry

    • Ensure consistent detergent:protein ratios across preparations

  • Lipid analysis:

    • Identify and quantify co-purified lipids using TLC or LC-MS

    • Establish a characteristic lipid profile for functional preparations

  • Functional benchmarking:

    • Develop standardized activity or binding assays

    • Compare each preparation to an established reference standard

When applying the WRAP technology , quality control should also assess the integrity of the WRAP-protein complex using similar methods, with particular attention to the maintenance of the designed interface between the WRAP domains and the membrane protein.

What standardization approaches should be implemented when comparing different preparations of UPF0283 membrane protein?

Standardization is crucial when comparing different preparations of UPF0283 membrane protein VV1_2269, especially when assessing functional or structural properties. Implementing the following approaches can ensure reliable and reproducible comparisons:

  • Quantification standardization:

    • Use multiple protein quantification methods (Bradford, BCA, and amino acid analysis)

    • Establish correction factors for detergent interference in concentration measurements

    • Report both total protein concentration and effective concentration (accounting for purity)

  • Purity assessment standardization:

    • Implement consistent SDS-PAGE analysis protocols with densitometry

    • Use the same molecular weight markers across all analyses

    • Establish minimum purity thresholds (e.g., >90% as indicated in specifications)

  • Functional activity standardization:

    • Develop reference standards with assigned activity units

    • Include positive and negative controls in all functional assays

    • Use the same buffer compositions and assay conditions across preparations

  • Structural characterization standardization:

    • Collect CD spectra under identical conditions (protein concentration, path length, buffer)

    • Process thermal stability data using consistent algorithms

    • Implement standardized SEC protocols (column type, flow rate, buffer composition)

  • Data reporting standardization:

    • Create standardized data sheets for each preparation including:

      • Expression conditions

      • Purification protocol details

      • Quality control results

      • Stability during storage assessment

For researchers working with WRAPed versions of the protein , additional standardization measures should address the consistency of the WRAP design and the protein-WRAP interface properties. This ensures that observed functional differences are attributed to the membrane protein itself rather than variations in the solubilization method.

What approaches could help elucidate the functional role of UPF0283 membrane protein VV1_2269 in Vibrio vulnificus?

Elucidating the functional role of UPF0283 membrane protein VV1_2269 in Vibrio vulnificus requires a multi-faceted approach combining computational predictions, experimental validation, and comparative analyses:

  • Computational functional prediction:

    • Apply advanced homology detection tools (HHpred, FFAS) to identify distant homologs

    • Utilize structure prediction (AlphaFold2) combined with structure-based function prediction

    • Perform genomic context analysis to identify conserved gene neighborhoods

    • Apply co-evolution analysis to predict potential interaction partners

  • Gene disruption and phenotypic analysis:

    • Generate knockout or conditional mutants in Vibrio vulnificus

    • Perform comprehensive phenotypic profiling under various conditions

    • Analyze transcriptomic and proteomic changes in mutant strains

    • Conduct complementation studies to confirm phenotype-genotype relationships

  • Localization and interaction studies:

    • Determine precise subcellular localization using fluorescent protein fusions

    • Identify interaction partners through pull-down assays and mass spectrometry

    • Utilize antibody-based microarray technology for cell surface interaction studies

    • Perform crosslinking experiments to capture transient interactions

  • Structural studies using WRAP technology:

    • Apply the WRAP solubilization approach to obtain stable, soluble protein

    • Perform structural analysis via cryo-EM or X-ray crystallography

    • Identify potential binding pockets or active sites

    • Use structure-guided mutagenesis to test functional hypotheses

The combination of these approaches, particularly the application of novel technologies like WRAP for structural studies and antibody microarrays for interaction analysis, provides a comprehensive strategy for functional characterization of this uncharacterized membrane protein.

How might the WRAP technology be optimized specifically for UPF0283 membrane protein research?

Optimizing WRAP technology specifically for UPF0283 membrane protein research would require targeted modifications of the general approach described in the literature , tailored to the unique characteristics of this protein:

  • Customized WRAP design considerations:

    • Generate multiple WRAP designs varying in the number and arrangement of helical elements

    • Optimize the hydrophobic-hydrophilic interface based on the predicted transmembrane topology of UPF0283

    • Incorporate specific interaction motifs that may stabilize unique structural features of UPF0283

    • Design selective binding sites for cofactors or substrates that might be essential for function

  • WRAP-UPF0283 fusion optimization:

    • Test various linker lengths and compositions to identify optimal connectivity

    • Explore alternative positioning of the WRAP domains relative to UPF0283

    • Consider dual WRAP designs that encapsulate the protein from multiple sides

    • Incorporate cleavable linkers to allow separation of the WRAP domains if needed for specific assays

  • Machine learning refinements:

    • Train specialized versions of the design algorithms using data from bacterial membrane proteins

    • Incorporate Vibrio vulnificus-specific sequence features into the design process

    • Utilize experimental feedback to improve subsequent design iterations

    • Develop specific scoring functions that account for the unique properties of UPF0283

  • Functional validation strategies:

    • Design WRAP variants that preserve hypothesized functional regions of UPF0283

    • Compare multiple WRAP designs for their impact on potential activities

    • Develop assays that can detect function in both WRAPed and native forms

    • Establish correlation between structural parameters and functional readouts

The successful application of WRAP technology to UPF0283 would not only advance research on this specific protein but could also establish a template for applying this approach to other uncharacterized membrane proteins from bacterial pathogens.

What potential biotechnological applications might emerge from detailed characterization of UPF0283 membrane protein?

Detailed characterization of UPF0283 membrane protein VV1_2269 could lead to several biotechnological applications, particularly given its origin from the pathogenic bacterium Vibrio vulnificus:

  • Therapeutic target development:

    • If found to be essential for bacterial survival or virulence, UPF0283 could serve as a novel antibiotic target

    • Structure-based drug design could yield specific inhibitors with reduced side effects

    • Peptide mimetics designed to interfere with UPF0283 function could represent a new class of antimicrobials

  • Diagnostic tool development:

    • Antibody-based detection systems similar to those described for cell surface proteomics

    • Biosensor development incorporating the purified protein or specific binding domains

    • Point-of-care tests for Vibrio vulnificus detection in clinical or environmental samples

  • Protein engineering platforms:

    • The WRAP technology applied to UPF0283 could establish a template for membrane protein solubilization

    • Engineered variants could serve as scaffolds for developing novel enzymatic activities

    • Designed protein-protein interaction systems based on the UPF0283 structure

  • Vaccine development considerations:

    • Assessment of UPF0283 as a potential vaccine antigen against Vibrio vulnificus

    • Application of the WRAP technology to generate soluble, structurally intact immunogens

    • Development of epitope-focused vaccines targeting specific regions of UPF0283

The WRAP technology has already demonstrated success in generating soluble versions of outer membrane proteins from Treponema pallidum as potential vaccine antigens . A similar approach could be applied to UPF0283, potentially contributing to vaccine development against Vibrio vulnificus, an important human pathogen associated with severe infections.

What is the optimal protocol for reconstituting UPF0283 membrane protein into proteoliposomes for functional studies?

Reconstituting UPF0283 membrane protein VV1_2269 into proteoliposomes requires a carefully optimized protocol to maintain functionality. Based on established methods for membrane protein reconstitution, the following procedure is recommended:

Materials:

  • Purified UPF0283 membrane protein (0.5-1 mg/ml in detergent)

  • Lipids: E. coli total lipid extract or synthetic mixture (POPC:POPE:POPG at 7:2:1 molar ratio)

  • Detergent (same as used during purification)

  • Bio-Beads SM-2 or Amberlite XAD-2

  • Reconstitution buffer: 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol

Procedure:

  • Liposome preparation:

    • Dissolve lipids in chloroform, dry under nitrogen, and lyophilize to remove all solvent

    • Hydrate lipids with reconstitution buffer to 10 mg/ml final concentration

    • Subject to 5 freeze-thaw cycles using liquid nitrogen and a 37°C water bath

    • Extrude through a 400 nm polycarbonate membrane to obtain uniform liposomes

  • Protein incorporation:

    • Solubilize prepared liposomes with detergent (final concentration at 1.5× CMC)

    • Add purified UPF0283 protein to achieve a protein:lipid ratio of 1:100 to 1:200 (w/w)

    • Incubate the mixture for 30 minutes at room temperature with gentle agitation

  • Detergent removal:

    • Add Bio-Beads SM-2 (80 mg/ml of solution) in three sequential additions:

      • First addition: Incubate for 2 hours at room temperature

      • Second addition: Incubate overnight at 4°C

      • Third addition: Incubate for 2 hours at room temperature

    • Remove Bio-Beads by gentle filtration

  • Proteoliposome recovery and characterization:

    • Collect proteoliposomes by ultracentrifugation (100,000 × g, 1 hour, 4°C)

    • Resuspend in fresh reconstitution buffer

    • Verify incorporation by:

      • Freeze-fracture electron microscopy

      • Sucrose density gradient centrifugation

      • SDS-PAGE analysis of recovered proteoliposomes

For researchers working with WRAPed versions of UPF0283, an alternative approach would be required since the protein would already be water-soluble. In this case, interaction with lipid membranes could be assessed through binding assays rather than reconstitution .

How can isotope labeling be optimized for structural studies of UPF0283 membrane protein?

Isotope labeling of UPF0283 membrane protein VV1_2269 for structural studies requires specific adaptations to address the challenges associated with membrane protein expression. The following optimized protocol focuses on producing isotopically labeled protein for NMR studies:

Materials:

  • E. coli expression strain (BL21(DE3) or C41(DE3))

  • Minimal medium components (M9 salts, trace elements, vitamins)

  • Isotopically labeled compounds (^15NH₄Cl, ^13C-glucose, D₂O)

  • Induction system (IPTG)

  • Purification reagents as described in basic protocols

Procedure:

  • Adaptation to minimal medium:

    • Perform sequential adaptation of the expression strain to M9 minimal medium

    • Start with an 80:20 LB:M9 mixture, then incrementally increase M9 proportion

    • Maintain good aeration during growth (>50% flask volume of culture)

  • Optimization for membrane protein expression:

    • Supplement minimal medium with additional nutrients:

      • 1 mM thiamine

      • 0.1 mM biotin

      • 1× RPMI 1640 amino acid solution (excluding amino acids to be labeled)

      • 0.5 g/L of Isogro (partially labeled algal extract)

  • Labeling strategies based on study requirements:

    Labeling SchemeApplicationProtocol Modifications
    Uniform ^15NBasic structure validationStandard M9 with ^15NH₄Cl (1 g/L)
    Uniform ^13C/^15NComplete structure determinationAdd ^13C-glucose (2-4 g/L)
    Selective amino acidSpecific region analysisAdd labeled amino acid + remaining unlabeled
    DeuterationImproved signal for large proteinsGrow in increasing D₂O concentrations
    SAILSite-specific labelingUse SAIL amino acids in cell-free expression
  • Expression protocol modifications:

    • Use lower induction temperature (18°C)

    • Extend expression time (16-24 hours)

    • Induce at slightly higher OD₆₀₀ (0.8-1.0) to ensure sufficient biomass

    • Add 0.5% glycerol as additional carbon source during induction phase

  • Sample preparation for NMR:

    • Use detergent with good NMR properties (LPPG, DPC, or DHPC)

    • Consider partial deuteration of detergents

    • Concentrate sample to 0.3-0.5 mM in low-salt buffer with 5-10% D₂O

For researchers employing the WRAP technology , isotope labeling can be selectively applied to either the membrane protein or the WRAP domains, facilitating segmental assignment and structural analysis of specific regions.

What high-throughput screening methodologies can be developed to identify potential ligands or interaction partners of UPF0283 membrane protein?

Developing high-throughput screening (HTS) methodologies for UPF0283 membrane protein VV1_2269 requires addressing the challenges associated with membrane protein stability while maintaining throughput. The following approaches are recommended:

  • Thermal shift assays (TSA) for ligand screening:

    • Adapt differential scanning fluorimetry to detergent-solubilized UPF0283

    • Use environment-sensitive fluorescent dyes (CPM or SYPRO Orange)

    • Screen compound libraries for molecules that enhance thermal stability

    • Implement in 384-well format for increased throughput

  • Surface plasmon resonance (SPR) screening:

    • Immobilize His-tagged UPF0283 on Ni-NTA sensor chips

    • Design a protocol for stable baseline and regeneration conditions

    • Screen for binding partners from prepared bacterial lysates

    • Validate hits using concentration-dependent binding studies

  • Antibody microarray-based screening:

    • Develop antibody microarrays targeting UPF0283 as described for cell surface proteomics

    • Screen for conditions that alter UPF0283 expression or modification

    • Identify potential interaction partners through co-localization studies

    • Pair with digital holography for label-free detection

  • WRAP-enabled soluble protein screening:

    • Generate WRAPed UPF0283 using described methodology

    • Apply standard soluble protein HTS methods without detergent complications

    • Include AlphaScreen, FRET-based assays, or biochemical activity screens

    • Perform microarray-based screening of the solubilized protein

  • In silico pre-screening to enhance efficiency:

    • Perform virtual screening against predicted binding pockets

    • Use molecular dynamics simulations to identify stable binding modes

    • Prioritize compounds based on predicted binding energy and drug-like properties

    • Select diverse chemical scaffolds for experimental validation

The implementation of WRAPed UPF0283 would significantly simplify HTS development by avoiding detergent-related complications and providing a stable, soluble protein format compatible with standard screening platforms. This approach has been successfully demonstrated for other membrane proteins, enhancing their stability while preserving functional properties.

What are the key considerations for researchers beginning work with UPF0283 membrane protein VV1_2269?

Researchers beginning work with UPF0283 membrane protein VV1_2269 should consider several key factors to establish successful experimental systems:

  • Expression and purification optimization:

    • Select appropriate expression systems, with E. coli being the proven initial choice

    • Optimize purification protocols focusing on detergent selection and buffer composition

    • Implement quality control measures to ensure consistent protein preparations

    • Consider the WRAP technology as an alternative to traditional detergent-based approaches

  • Structural characterization strategy:

    • Begin with computational structure prediction using AlphaFold2

    • Perform CD spectroscopy to confirm secondary structure content

    • Progress to more advanced techniques (cryo-EM, NMR) as resources allow

    • Use the predicted structure to guide functional hypotheses

  • Functional investigation approaches:

    • Conduct bioinformatic analyses to predict potential functions

    • Design screening assays for possible activities based on predicted structure

    • Develop recombinant antibody-based detection systems

    • Establish bacterial genetic systems for in vivo functional studies

  • Technology selection guidance:

    • For structural studies: WRAP technology shows promise for membrane protein solubilization

    • For interaction studies: Antibody microarrays provide a sensitive detection platform

    • For functional characterization: Consider reconstitution into proteoliposomes or nanodiscs

By systematically addressing these considerations, researchers can establish robust experimental systems for studying this uncharacterized membrane protein from Vibrio vulnificus, potentially leading to novel insights into bacterial physiology and pathogenesis.

What research gaps remain in our understanding of UPF0283 membrane protein VV1_2269 and related proteins?

Despite the available information on UPF0283 membrane protein VV1_2269, significant research gaps remain that require focused investigation:

  • Structural characterization gaps:

    • No experimental three-dimensional structure is available for UPF0283 or close homologs

    • The membrane topology and oligomeric state remain unconfirmed

    • Potential conformational dynamics and structural transitions are unexplored

    • Structural basis for potential substrate recognition or protein-protein interactions is unknown

  • Functional characterization gaps:

    • The physiological role of UPF0283 in Vibrio vulnificus remains uncharacterized

    • Potential enzymatic activities or transport functions are undetermined

    • The impact of UPF0283 on bacterial virulence or survival has not been established

    • Regulation of UPF0283 expression in response to environmental cues is poorly understood

  • Evolutionary context gaps:

    • Distribution and conservation of UPF0283 family members across bacterial species require systematic analysis

    • Evolutionary relationships with functionally characterized proteins remain to be established

    • Potential horizontal gene transfer events and their implications are unexplored

    • Structural and functional divergence within the UPF0283 family needs characterization

  • Technological approach limitations:

    • Optimization of WRAP technology specifically for UPF0283 has not been reported

    • Application of antibody microarray technology to UPF0283 detection requires development

    • High-resolution structural studies using cryo-EM or X-ray crystallography are lacking

    • Functional assays specific to UPF0283 need development and validation

Addressing these research gaps will require multidisciplinary approaches combining computational prediction, structural biology, functional genomics, and biochemical characterization. The application of novel technologies like WRAP solubilization and antibody microarrays represents promising strategies for overcoming the challenges associated with membrane protein research.

How might emerging technologies beyond WRAP impact future research on UPF0283 membrane protein?

Emerging technologies beyond WRAP hold significant promise for advancing research on UPF0283 membrane protein VV1_2269. These innovative approaches could address current limitations and open new avenues for investigation:

  • AlphaFold and deep learning advances:

    • Improved prediction of membrane protein structures with specialized versions of AlphaFold

    • Integration of experimental constraints with AI-based structure prediction

    • Prediction of protein-protein interactions and complex formation

    • AI-guided protein engineering for enhanced stability or introduced functionality

  • Cryo-EM technological developments:

    • Advances in single-particle analysis of smaller membrane proteins

    • Improved resolution for membrane protein complexes

    • Development of specialized sample preparation methods for membrane proteins

    • Integration with mass photometry for heterogeneity analysis

  • Native mass spectrometry innovations:

    • Enhanced analysis of membrane proteins with bound lipids or detergents

    • Improved detection of post-translational modifications in membrane proteins

    • Characterization of weak or transient protein-protein interactions

    • Coupling with ion mobility for structural constraint generation

  • Microfluidic and organ-on-chip platforms:

    • Analysis of membrane protein function in biomimetic membrane environments

    • Real-time monitoring of transport activities or conformational changes

    • Integration with biosensing technologies for detection of ligand binding

    • High-throughput screening in physiologically relevant contexts

  • CRISPR-based functional genomics:

    • Systematic characterization of UPF0283 function through genome-wide interaction screens

    • CRISPRi/CRISPRa approaches for modulating UPF0283 expression

    • Base editing for structure-function relationship studies

    • In vivo tracking of UPF0283 interactions using proximity labeling

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.