Recombinant UPF0283 membrane protein YcjF (ycjF)

What is UPF0283 membrane protein YcjF and why is it significant for research?

UPF0283 membrane protein YcjF is a 353-amino acid membrane protein found in Escherichia coli. The protein belongs to the UPF (Uncharacterized Protein Family) 0283 class, indicating that its precise biological function remains to be fully elucidated. YcjF is significant for research primarily because it represents an important component of E. coli membrane biology, potentially involved in cellular processes that could be relevant to bacterial physiology, pathogenesis, or resistance mechanisms. As a membrane protein in one of the most widely studied prokaryotic model organisms, YcjF provides researchers with opportunities to investigate fundamental aspects of bacterial membrane structure and function .

What are the structural characteristics of recombinant YcjF protein?

The recombinant UPF0283 membrane protein YcjF consists of 353 amino acids with the sequence: MTEPLKPRIDFDGPLEVDQNPKFRAQQTFDENQAQNFAPATLDEAQEEEGQVEAVMDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVV TEWRRLWRLRQRAHERDEARDLLHSHGTGKGRAFCEKLAQQAGIDQSHPALQRWYASIHE TQNDREVVSLYAHLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFKLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDDDKPRLGDFRRQLIGQVKETLQKGKTPSEK . Analysis of the sequence suggests it contains multiple hydrophobic regions consistent with its classification as a membrane protein. The protein can be produced as a full-length recombinant protein with N-terminal His-tags to facilitate purification and experimental manipulation . Current structural data indicates YcjF likely adopts a conformation that allows it to integrate into bacterial membranes, though high-resolution crystallographic or cryo-EM structures would provide more definitive information about its three-dimensional arrangement.

What expression systems are commonly used for producing recombinant YcjF?

Recombinant YcjF is typically expressed using several potential expression systems, with E. coli being the most commonly employed host. According to available data, the following expression systems can be utilized:

For basic research applications, E. coli expression systems are frequently selected due to their efficiency in producing UPF0283 membrane protein YcjF with suitable purity for most applications . The specific choice depends on the experimental requirements and the need for post-translational modifications that might be essential for protein function.

What are the optimal conditions for reconstitution of lyophilized YcjF protein?

For optimal reconstitution of lyophilized UPF0283 membrane protein YcjF, researchers should follow a methodical approach to maintain protein integrity and function. Based on available protocols, reconstitution should be performed as follows:

• Briefly centrifuge the vial containing lyophilized protein prior to opening to bring contents to the bottom.

• Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL.

• For long-term storage stability, add glycerol to a final concentration between 5-50% (with 50% being commonly recommended).

• Aliquot the reconstituted protein to minimize freeze-thaw cycles.

• Store aliquots at -20°C or preferably -80°C for maximum stability .

It is important to note that repeated freeze-thaw cycles significantly reduce protein activity and should be avoided. When using reconstituted YcjF for experiments, working aliquots can be stored at 4°C for up to one week . These conditions help maintain the structural and functional integrity of the protein for research applications.

What purification strategies yield the highest purity of recombinant YcjF protein?

High-purity recombinant YcjF protein can be obtained through a strategic purification workflow that leverages the protein's properties and commonly incorporated affinity tags. The most effective purification strategy typically involves:

• Affinity Chromatography: Using Ni-NTA or similar metal affinity resins to capture His-tagged YcjF protein. This step typically achieves >85% purity .

• Size Exclusion Chromatography (SEC): Further purification can be achieved by separating the protein based on molecular size, which helps remove aggregates and contaminating proteins of different sizes.

• Ion Exchange Chromatography: Depending on the isoelectric point of YcjF, either cation or anion exchange chromatography can be employed as a polishing step.

This multi-step approach consistently yields protein with >90% purity as determined by SDS-PAGE analysis . For membrane proteins like YcjF, inclusion of appropriate detergents throughout the purification process is critical to maintain solubility and native conformation. Common detergents include n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations just above their critical micelle concentration (CMC).

What experimental approaches can determine the membrane topology of YcjF?

Determining the membrane topology of UPF0283 membrane protein YcjF requires specialized techniques that can identify transmembrane domains and their orientation. Recommended experimental approaches include:

• Cysteine Scanning Mutagenesis and Accessibility Studies: By systematically replacing amino acids with cysteines and testing their accessibility to membrane-impermeable labeling reagents, researchers can map which regions are exposed to either side of the membrane.

• Protease Protection Assays: This approach involves treating intact bacterial cells or membrane vesicles with proteases that cannot cross membranes, followed by mass spectrometry analysis to identify protected fragments.

• GFP-fusion Reporter System: Creating fusion proteins with GFP at various positions can help determine which regions are cytoplasmic (fluorescent) versus periplasmic or extracellular (often non-fluorescent in bacterial systems).

• Epitope Insertion and Antibody Accessibility: Inserting small epitope tags at various positions and testing their accessibility to antibodies in intact versus permeabilized cells.

These complementary approaches collectively provide robust data on the membrane topology of YcjF. The hydrophobicity profile of YcjF's amino acid sequence (MTEPLKPRIDFDGPLEVDQNPKFRAQQTFDENQAQNFAPATLDEAQEEEGQVEAVMDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVV TEWRRLWRLRQRAHERDEARDLLHSHGTGKGRAFCEKLAQQAGIDQSHPALQRWYASIHE TQNDREVVSLYAHLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFKLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDDDKPRLGDFRRQLIGQVKETLQKGKTPSEK) suggests multiple potential transmembrane segments that would need to be experimentally verified .

How can researchers effectively study protein-protein interactions involving YcjF?

To effectively study protein-protein interactions involving YcjF, researchers should consider multiple complementary techniques that are particularly suited for membrane proteins:

• Co-immunoprecipitation (Co-IP) with Membrane-Compatible Detergents: Using mild detergents such as digitonin or CHAPS that preserve protein-protein interactions while solubilizing membrane proteins.

• Bacterial Two-Hybrid Systems: Modified for membrane proteins, these genetic systems can detect interactions in a cellular context.

• Proximity Labeling Approaches: BioID or APEX2 fusion proteins can identify proximal proteins in living cells, which is particularly valuable for transient interactions.

• Surface Plasmon Resonance (SPR): For in vitro validation of direct interactions, using recombinant YcjF immobilized on sensor chips with appropriate membrane-mimetic surfaces.

• Isothermal Titration Calorimetry (ITC): For quantitative measurement of binding affinities between YcjF and potential interaction partners in detergent micelles.

Each method has specific advantages, and combining multiple approaches provides more reliable results. When designing these experiments, researchers should consider the membrane environment of YcjF and ensure that experimental conditions support the native conformation of the protein, typically by including appropriate detergents or lipids .

What methodologies are most effective for studying the potential role of YcjF in bacterial pathogenesis?

To investigate the potential role of UPF0283 membrane protein YcjF in bacterial pathogenesis, researchers should implement a multi-faceted approach:

• Gene Knockout and Complementation Studies: Creating ycjF deletion mutants in pathogenic E. coli strains followed by phenotypic characterization in infection models. Complementation with wild-type gene confirms specificity of observed phenotypes.

• Conditional Expression Systems: Using inducible promoters to control YcjF expression levels during different stages of infection to identify stage-specific requirements.

• Transcriptomics Analysis: RNA-seq comparing wild-type and ycjF mutant strains under infection-relevant conditions to identify downstream effects on virulence gene expression.

• Infection Models: Testing ycjF mutants in appropriate cell culture and animal models of infection, with quantitative measurements of bacterial colonization, persistence, and host response.

• Intracellular Tracking: Using fluorescently tagged YcjF to monitor its localization during host cell interaction or infection processes.

This comprehensive approach allows researchers to determine whether YcjF contributes to specific virulence mechanisms such as adhesion, invasion, immune evasion, or stress resistance. The protein's membrane localization suggests it may play a role in bacterial-host interactions or in maintaining membrane integrity under host-imposed stress conditions .

How can structural studies of YcjF be optimized for membrane protein crystallography?

Optimizing structural studies of YcjF for membrane protein crystallography presents specific challenges that can be addressed through the following methodological approaches:

• Construct Optimization:

  • Create multiple constructs with varied N- and C-terminal boundaries

  • Remove flexible regions that might hinder crystallization

  • Consider fusion partners (e.g., T4 lysozyme) that facilitate crystal contacts

• Protein Stability Enhancement:

  • Perform thermal stability assays (TSA) with different detergents

  • Screen stabilizing additives and ligands

  • Consider introducing stabilizing mutations based on evolutionary analysis

• Crystallization Strategy:

  • Employ lipidic cubic phase (LCP) crystallization methods

  • Screen detergent-lipid mixtures extensively

  • Consider antibody fragment co-crystallization to create crystal contacts

• Alternative Approaches:

  • Single-particle cryo-electron microscopy (cryo-EM)

  • Solid-state NMR for specific structural elements

  • Electron crystallography of 2D crystals

The full-length sequence of YcjF (353 amino acids) may need to be optimized for crystallization success . A systematic approach testing multiple conditions is recommended, with protein quality control performed at each step using techniques such as size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to ensure monodispersity of the protein-detergent complex.

How do YcjF proteins from different E. coli strains compare, and what are the functional implications?

Comparative analysis of YcjF proteins from different E. coli strains reveals both conserved features and strain-specific variations that may have functional implications:

Structural modeling of strain-specific variants, coupled with functional assays comparing the complementation efficiency of different ycjF alleles, would help elucidate whether sequence variations translate to functional differences. This comparative approach is particularly valuable for understanding the evolution of membrane proteins in different ecological niches.

What are the recommended approaches for investigating potential post-translational modifications of YcjF?

Investigating potential post-translational modifications (PTMs) of YcjF requires specialized techniques sensitive enough to detect modifications in membrane proteins. Recommended approaches include:

• Mass Spectrometry-Based Proteomics:

  • Enrichment strategies for specific PTMs (phosphorylation, glycosylation, etc.)

  • Multiple proteases for complete sequence coverage

  • Targeted MS/MS approaches for low-abundance modifications

• Site-Directed Mutagenesis:

  • Mutation of predicted modification sites followed by functional assays

  • Creation of modification-mimicking mutations (e.g., phosphomimetic)

• PTM-Specific Antibodies:

  • Development or use of existing antibodies against common PTMs

  • Western blotting with and without treatments that affect modifications

• Expression System Selection:

  • Comparison of YcjF expressed in different systems (E. coli, yeast, mammalian cells)

  • Analysis of functional differences correlated with modification patterns

• In Vitro Modification Assays:

  • Testing purified YcjF as a substrate for various modifying enzymes

  • Monitoring changes in activity or conformation following modification

While E. coli proteins generally undergo fewer PTMs than eukaryotic proteins, bacterial membrane proteins can still experience modifications such as phosphorylation, methylation, or lipidation that may regulate their function or localization. The specific choice of expression system (E. coli, yeast, baculovirus, or mammalian cell) may affect the PTM profile of recombinant YcjF, potentially impacting functional studies .

How can YcjF be utilized in vaccine development research?

UPF0283 membrane protein YcjF offers several potential applications in vaccine development research, particularly for vaccines targeting E. coli and related pathogens:

• Antigen Discovery and Evaluation:

  • YcjF can be evaluated as a potential vaccine antigen, especially if it is found to be exposed on the bacterial surface

  • Immunogenicity studies using purified recombinant YcjF to assess antibody responses

  • Conservation analysis across strains to determine breadth of potential protection

• Adjuvant Development:

  • Investigation of YcjF or its domains as potential immune-stimulating components

  • Carrier protein for conjugate vaccine approaches

• Delivery System Research:

  • Incorporation into outer membrane vesicles (OMVs) or liposomes for vaccine delivery

  • Study of membrane protein presentation in various delivery platforms

• Immunological Research:

  • Analysis of immune responses (humoral and cellular) against bacterial membrane proteins

  • Epitope mapping to identify immunodominant regions

It is critical to note that while YcjF may be utilized in vaccine research contexts, recombinant YcjF products themselves are strictly for research purposes only and cannot be used directly in humans or animals . Vaccine development would require extensive additional testing, formulation development, and clinical trials following initial research phases.

What are the emerging techniques for studying membrane protein dynamics that could be applied to YcjF?

Emerging techniques for studying membrane protein dynamics offer new opportunities for understanding the structural flexibility and conformational changes of YcjF:

• Single-Molecule Förster Resonance Energy Transfer (smFRET):

  • Allows measurement of distance changes between labeled residues

  • Can capture rare conformational states and transitional dynamics

  • Applicable to YcjF by introducing paired fluorophores at strategic positions

• Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Provides information on solvent accessibility and structural flexibility

  • Can be adapted for membrane proteins with appropriate detergent systems

  • Would help identify dynamic regions of YcjF under different conditions

• Molecular Dynamics Simulations in Native-like Membranes:

  • All-atom simulations in complex lipid environments

  • Coarse-grained approaches for longer timescale dynamics

  • Virtual screening of potential ligands or interaction partners

• Nanodiscs and Lipid Bilayer Technologies:

  • Reconstitution of YcjF into nanodiscs for functional studies in defined lipid environments

  • Planar lipid bilayer electrical recordings if YcjF has channel-like properties

  • Microscale thermophoresis for interaction studies in membrane mimetic systems

• Cryo-Electron Tomography:

  • Visualization of YcjF in its native membrane environment

  • Structural analysis in the context of the bacterial envelope

These techniques collectively provide complementary information about the dynamic behavior of membrane proteins like YcjF, potentially revealing functional mechanisms that cannot be captured by static structural studies alone. The integration of these approaches with traditional biochemical assays would provide the most comprehensive understanding of YcjF's role in bacterial physiology .